KEGG   Hydra vulgaris: 100205790Help
Entry
100205790         CDS       T01080                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit PRKX-like
Organism
hmg  Hydra vulgaris
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_C
Motif
Other DBs
NCBI-GeneID: 100205790
NCBI-ProteinID: XP_012555952
LinkDB All DBs
Position
Un
AA seq 537 aa AA seqDB search
MGEAVSDGFATVYNSNTFSNNNCVGKAFNINVDENNVGKSSSLQNLLIVAPNQIGNKKIK
VLSISQDFKRDNKNNCCAEDKSLCPRNGAFYVEKALTKSLLRFPVNNLKIDSQNDSISLE
SSLRKSISSDNIKQDKKVNETSETSVSKPFHQINAKSKTQDSEIDCNLLISKASANDKNK
VTNGIGTDKDNIEQACQLFNDTMQLTQTNTDQKKKETKISFADLSFLKTLGTGTFGRVLL
AESKKSNLYYAIKALLIRDVIRLNQVEHSNNERKILLSINHPFIVKCYDSFADSKCLYLI
MEYVPGGELFSYLRKMERFPEKTAFFYITEIICVLEYLHLKSIVYRDLKPENLLLDAKGH
LKLTDFGFAKYLENTTWTLCGTPEYLSPEVIQGKGHDFSCDWWALGILSYEMLVGEAPFI
DDHPFGLYEKILDCKVTWPDDLKNSVSKDFISKLIVADRSTRLGKGKHGFEAIKAHCWFD
RIDWNRVLQQKYRTPFQPVLRSDHDTSNFDEFDDEWNLESASSSSENEKKNFSEWYT
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagcagtttctgacggctttgcaacggtttataactcaaatactttttctaac
aacaattgcgttgggaaagcgtttaatattaatgtcgatgaaaataacgttgggaagagc
agcagccttcaaaatctattaattgtggcaccaaatcaaattggcaacaaaaaaattaag
gttttatctattagtcaagactttaaacgagacaataaaaacaattgctgcgcagaagat
aaaagtttgtgtccgagaaatggagctttttatgttgaaaaagcgttaacaaaatcgtta
cttcgttttccagtaaacaatctaaagatagattctcaaaatgattccatttcattagag
tcctctctgcgaaaaagtataagctctgataatataaagcaagataaaaaagtaaacgaa
acttcagagacaagtgtttctaaaccgtttcaccaaatcaatgctaaatccaaaacccag
gattcagaaatcgactgcaatttgttgatatcgaaagctagtgccaatgacaaaaataaa
gttacaaatggcataggaacagataaagacaatattgagcaagcttgtcagttatttaat
gataccatgcagttaacccagacaaatacagaccagaaaaaaaaagaaacaaagataagt
tttgcagacttaagctttttaaaaacgttaggaacaggtacttttggaagagttcttctg
gcggaatccaaaaaatcaaatttatattatgctatcaaagccctattaatacgtgatgtt
attcgattaaaccaggttgaacatagcaacaatgaaaggaaaatcttattgagcattaat
cacccgtttattgtaaaatgctacgattcatttgctgactcaaagtgtctttatttgatc
atggaatatgtgcctggaggagaattattttcttatttgcgaaagatggaacggtttccg
gaaaagacggcatttttttacataactgaaattatttgtgtattagaatatcttcatttg
aagagcatagtttacagggatcttaaacctgaaaatcttctgctagatgctaaaggtcat
ttaaagttaacagattttggatttgcaaaatatcttgaaaatacaacatggacactatgt
ggaactccagaatatttatctccagaagtaattcagggtaaaggacatgatttttcctgt
gactggtgggcactgggcattctaagttatgaaatgcttgttggagaggctccgtttatt
gatgatcatccatttggcttgtatgaaaaaatattagattgtaaagtaacctggccagat
gatttaaaaaatagtgtttcaaaggactttattagtaagcttattgttgctgatagatca
acaagacttggaaaaggaaagcatgggtttgaagcaataaaagctcattgttggtttgat
cgaatcgattggaatcgcgtgttgcaacaaaagtatcgaactccctttcaaccggttctg
aggagcgaccatgatactagcaactttgatgaatttgacgatgaatggaatctggaatct
gcatcaagctccagtgaaaatgaaaagaaaaattttagcgaatggtatacataa

DBGET integrated database retrieval system