KEGG   Hydra vulgaris: 100206246Help
Entry
100206246         CDS       T01080                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
hmg  Hydra vulgaris
Pathway
hmg03030  DNA replication
hmg03410  Base excision repair
hmg03420  Nucleotide excision repair
hmg03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100206246
   03410 Base excision repair
    100206246
   03420 Nucleotide excision repair
    100206246
   03430 Mismatch repair
    100206246
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hmg03032]
    100206246
   03400 DNA repair and recombination proteins [BR:hmg03400]
    100206246
Enzymes [BR:hmg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100206246
    6.5.1.6  DNA ligase (ATP or NAD+)
     100206246
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100206246
DNA replication proteins [BR:hmg03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100206246
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100206246
DNA repair and recombination proteins [BR:hmg03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100206246
   NER (nucleotide excision repair)
    Other NER factors
     100206246
   MMR (mismatch exicision repair)
    Other MMR factors
     100206246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 100206246
NCBI-ProteinID: XP_012559654
LinkDB All DBs
Position
Un
AA seq 885 aa AA seqDB search
MPQKTIGSFFTKKAEQKKENGTSERLYLENEKSSDVKCKEDEHKDQTIDNPVVSLEKENE
HSKSFLDASKTIINEEIPIKRKTARKTVVGPKKPNEQLRNDLQPIESTNKSFENSVKCDS
PSKDPFDGNENHKIFNENVDNHTTASTKRKNNEESPEKSIDVKSSSFFAKKPRLEKKNKK
LPVSLEETKEEILEPKLDVVDQPSPSHKKPDSVKNGKKDCLKPDCVKPDKFNPASSTYHP
MKNACWCKNENVPYEALTRTFQEIEEISARLKIQSVLCNFFRSVIVLTPNDLLPCVYLCL
NKLAPAYEGMELGIGENVLMKAVCSSTGKNMTQIKAEVAEKGDLGIVAESCRSNQRMMFA
PPSLTVSGVFKKLKNIAEMTGHSSMAKKIEIIQQMFVACKNSEARYLIRSLGGKLRIGLA
EQSVLSALGQAVVLTPPGQDYPPQIIDASTILSSEKLKAECDEASLAIKTAYCELPSYDI
IIPQLLLNGWRKLPLTCHITPGIPLKPMLAHPTKGVSEVLKRFDDAKFVCEYKYDGERAQ
IHLLDNGEVKIYSRNQENNTSKYPDIVARIPKVIKTHVRSCIIDTESVAWDQENKRILPF
QVLTTRKRKDVEENDIKVQVCVHAFDLLYLNGESLVGKPFSKRRELLMSAFNQVEGEFVF
ATAKILSDTDEISEFLDESIQGNCEGLMLKTLDVDATYEIAKRSHNWLKLKKDYLEGVGD
TLDLVVIGGYHGTGKRTGKYGGYLLACYDEDNEEYQTICKAGTGFTDEQLAKHYEFFKNH
VIEKPRSYYRFDDGMKPDHWFEPVQVWEIRAADLSISPIYRAAIGIVDPDKGISLRFPRF
LRVRDDKKPEEATLSQQVAEFYNNQDQIKNASDFKSKSKIEEDFY
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgccacagaagacgattggttctttttttacaaaaaaagctgagcaaaagaaggagaat
ggaacatctgaaagactttatcttgaaaatgaaaaaagcagtgatgttaaatgtaaagaa
gatgaacataaagatcagacaatagataatcctgtggtttctttggaaaaagaaaatgaa
cattcaaaaagttttttggatgcttcaaaaacaattattaatgaagaaattccaataaag
cgaaaaacagcaagaaaaacagtagttggtccaaagaaaccaaatgaacaactaaggaat
gatttacaacccatagaatctactaataagtcatttgaaaattcagtaaaatgtgattca
ccaagtaaagacccttttgatggaaatgaaaaccataagattttcaatgaaaatgtagat
aatcatacaaccgcatcaacaaagcgcaaaaacaatgaagaatctcctgaaaaatcaatt
gatgtaaagtcttcaagtttttttgccaaaaaacctcgtcttgagaaaaaaaataaaaaa
cttccagtgtctttagaagaaacaaaagaagagatattagaaccaaaattagatgtggtg
gatcagccttcaccatctcataagaaacctgattctgtaaaaaatggcaaaaaagattgt
ctaaagcctgattgtgtaaaacctgacaaatttaatcctgcatcttctacttaccatcct
atgaaaaatgcttgctggtgcaaaaatgagaatgttccttatgaagctttaacaagaact
tttcaagaaatagaggaaatatcagcaagattaaaaattcaatcggtgctgtgcaatttt
tttcgctctgttattgtcttgacaccaaatgatttgttgccttgtgtttatttgtgttta
aataaattagctccagcatatgaaggtatggaactaggaattggtgaaaatgttttgatg
aaagctgtttgctcttcaacaggcaaaaacatgactcaaataaaagctgaagttgcagaa
aaaggagaccttggaatagttgcagagagttgtcgctctaatcagcgtatgatgttcgct
cccccttcattaacagttagtggtgtcttcaaaaaattgaaaaatatagctgaaatgaca
ggtcattcgtctatggcaaaaaaaattgaaataattcaacagatgtttgtagcatgcaaa
aattcagaagcaagatatttaattaggtcattaggtggtaaactaagaattggtcttgca
gaacagtctgtgttatctgctttaggacaagccgttgtattaactcctccaggtcaagat
tatcctccacaaattattgatgcaagtacaattttgtcttcagaaaaactgaaggctgaa
tgtgatgaggcttcattggccatcaaaacagcttattgtgaactaccatcatatgatata
attatacctcaactgttgttaaatggttggagaaaattgccactaacatgccatataaca
ccaggaataccattaaaacctatgttggcacatcctacaaaaggagtgagtgaagttcta
aaacgatttgatgatgcaaagtttgtttgtgagtataaatatgatggagagcgagcccaa
attcatttgcttgacaatggtgaagttaagatatatagcagaaaccaagaaaataataca
tctaaatatccagatattgttgcacgaatacctaaggtaataaaaacacatgtacggtct
tgtattattgacactgagtctgtggcctgggatcaagagaataaaagaattctacctttt
caagtgttgacaacaagaaagcgaaaggatgtagaagaaaatgacattaaagttcaagtt
tgtgtacatgcgtttgacttgttgtacctaaatggcgagtctttagtgggtaaaccattt
agtaaaagaagggaattgctgatgtctgcatttaatcaagttgaaggggaatttgttttt
gctactgcaaagattctaagtgacacagatgaaatttcagaatttcttgatgaatctata
caaggtaattgtgaaggactgatgttgaaaactttagatgttgacgctacttatgaaatt
gcaaagcgatcccataattggttaaagcttaagaaagattatttagagggggttggagac
acgcttgatttagttgttattggtggatatcatgggactggtaaaagaacaggaaagtat
gggggatacctgctggcatgttatgatgaagataacgaggaataccaaacaatatgcaag
gctggtactggcttcacggacgagcaattagctaagcactatgagttcttcaaaaatcat
gtcattgaaaaaccgcgctcgtattaccgatttgatgacggcatgaaaccagaccattgg
tttgaaccagtacaagtttgggaaatacgtgccgctgatttatctatctctccaatttac
agagcagctattggaatcgttgatcctgataaaggaatttcgcttcgttttccgcgtttt
ttacgtgtgcgagatgacaaaaagcctgaagaagctacattgtcacaacaagtagctgaa
ttttataataatcaagaccagattaaaaatgccagcgattttaaatctaaatccaagatc
gaagaagatttctactga

DBGET integrated database retrieval system