KEGG   Hydra vulgaris: 100207345Help
Entry
100207345         CDS       T01080                                 

Definition
(RefSeq) protein phosphatase 1 regulatory subunit 7-like
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
hmg  Hydra vulgaris
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hmg01009]
    100207345
Protein phosphatases and associated proteins [BR:hmg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100207345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_9 LRR_8
Motif
Other DBs
NCBI-GeneID: 100207345
NCBI-ProteinID: XP_002153798
UniProt: T2MDE7
LinkDB All DBs
Position
Un
AA seq 316 aa AA seqDB search
MENMTESSDEEHNNEDKDNIESTDFVSLIKEDEEYVDLTHARLGRVPDLTHVTKIKSLCL
RENLIKDWDGLSLLTTLESLDLYDNLLTNIKSIETLTNLNYLDVSFNKVKKIENIDLLVN
LEKLFLIRNKLSKIENLNSLTKLTLLELGSNRIRHIQGIECLVNLQELYLGQNKISKLEN
LTTLKKLKILSIQSNRILKIEGLEELEDLEEFYISFNGIEKIENLHCNKKLKTLDVGNNK
ISLIEGLDNLNELKEFWCNDNNVSDWKCTDILARLPYLETVYLERNPLQLNDQSGYRRKI
KLALPKLKQLDATLTG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggagaatatgacagaaagttcagatgaggaacataacaatgaagataaagataatata
gaatcaacagattttgttagcttgataaaagaagatgaagagtatgttgatttaactcat
gcgcgacttggaagagttcctgatttaactcatgttactaaaataaaaagtttatgtctt
cgcgagaacttgattaaagattgggatggattatctttactaactactcttgaatctcta
gatctttatgacaacctacttaccaatataaaaagcattgaaacgctcacaaatcttaac
tacctggatgtgtcatttaataaagtgaaaaagattgaaaacatcgacttattggttaac
ttggaaaagctttttttgattcgaaacaaactttcaaagatcgaaaatttaaatagtcta
acaaaattaacattattagaacttggatcaaatagaatcaggcatattcaaggaattgaa
tgccttgtgaatctgcaagagttatatttaggacaaaataaaatttcaaagcttgaaaat
ttaacaactttaaagaagttgaagattttaagtattcagagtaatcgaatcttaaagatt
gaagggttggaagaacttgaagatttagaagagttttacataagttttaatggaattgaa
aaaatagaaaatctccactgcaacaaaaaactaaaaactcttgatgttggcaataacaag
atttctcttattgaagggttggataacttaaatgagctcaaagaattttggtgcaacgat
aacaatgtcagtgattggaaatgtacagatattttagcaagacttccatatttagaaact
gtatatttagaacgaaatcctttgcagctaaatgatcagtcgggttatcgacgtaaaata
aagctggctttgccgaagctaaaacaattagatgcaacattgactggatag

DBGET integrated database retrieval system