KEGG   Hydra vulgaris: 100209916
Entry
100209916         CDS       T01080                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
hmg  Hydra vulgaris
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Clusterin Rsd_AlgQ
Other DBs
NCBI-GeneID: 100209916
NCBI-ProteinID: XP_012557286
UniProt: T2M4A9
LinkDB
Position
Un
AA seq 418 aa
MATPNSKKSEKKTSFFGGIFGGANRRTGKNSLVNYDYVKGVETIEYRRKSDGTVKQQIVE
KNSYQSYKAQYFRGHRFELYHKPTWCDICQELSWGLYAQSARCCFCRFTCHLKCVNSVSL
DCPKAPSIEKSFDEITKEVQEILSFQEGYEHVLVQNNNLPSFVTSLNHLRKLIEEFNSQS
PVIMTLHSDGTFDGFIRVHMNLNRPVNVSTDVSNLTLRKAVAAKRLSDSRRPLSEIFKPE
SSDRDSDAHSTPNFSHGNELSVLERRNTKPARRLSFYMPRGTYKPLHVTSTTTALEVISA
LLTKYNVTDNPKKFALYEKHVPAGDKNNKEATFRRLRGDENPLLLRLNWGALNTTDSFVL
KEDDEGPIQWTNFELPELANFLEILQMEEDAMLAQIYKRFELYKQSLQKAIELKDRIV
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcaactccaaattccaaaaaatcagaaaagaaaacaagtttttttggtggaattttt
ggaggtgcaaatcggagaaccggcaaaaattcattagtaaactatgattatgttaaagga
gttgaaactattgaatataggagaaaatctgatggaactgttaaacaacaaattgtagaa
aaaaattcttatcaatcttataaagcccagtattttagaggacataggtttgaattgtat
cataaaccaacttggtgtgacatttgtcaagaattatcatggggtttatatgctcaatct
gcaagatgctgtttctgtcgttttacttgtcacttaaaatgtgtaaattctgtgtctttg
gattgcccaaaagcaccatcaatagaaaaatcatttgatgagattacaaaagaagttcaa
gaaatattaagtttccaagagggatatgaacatgtattagttcaaaataataatttacct
agttttgtaacttctttaaatcatcttcgaaaacttattgaagaatttaactcccagtca
cctgttataatgacattacatagtgacgggacatttgatgggtttattcgcgtccacatg
aatctaaacagacctgtaaatgtttctactgatgtttcaaatttgacattaaggaaagca
gttgctgctaaacggttatcagattctcgaagacctctttcagaaatttttaagccagaa
agttctgatcgtgattcagatgcccattcgacaccaaatttttctcatggaaatgagtta
tcagttttagaaagaagaaatactaaacctgcacgaagactaagcttttatatgccaaga
ggaacatataaacctttgcatgtaactagtactacaactgcacttgaggtgattagtgcc
cttttaactaaatataatgtcactgataatccaaaaaaatttgcactttacgaaaagcat
gttccagcaggagacaaaaacaataaagaagcaacgtttcggcgattaagaggcgatgag
aatccattacttttacggttaaattggggggcattaaatactacagactcttttgtttta
aaggaagatgacgaaggtcctattcagtggacaaattttgagttacctgaattagcaaat
tttcttgagattttgcaaatggaggaagatgctatgttggctcagatatacaaaaggttt
gagttgtataagcaatcactgcaaaaagcaatcgagttaaaagatcgaatagtgtga

DBGET integrated database retrieval system