KEGG   Hydra vulgaris: 100210215Help
Entry
100210215         CDS       T01080                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
hmg  Hydra vulgaris
Pathway
hmg00020  Citrate cycle (TCA cycle)
hmg00190  Oxidative phosphorylation
hmg01100  Metabolic pathways
hmg01200  Carbon metabolism
Module
hmg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hmg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hmg_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100210215
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100210215
Enzymes [BR:hmg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100210215
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 100210215
NCBI-ProteinID: XP_002164117
LinkDB All DBs
Position
Un
AA seq 654 aa AA seqDB search
MISLQRCYFKKFTQLAPSCIRSFHFTIEGSRTGDKITKGELSRQYPVVDHTYDCVVVGAG
GAGLRAAFGLANAGFKTACVTKLFPTRSHTVAAQGGINAALGNMEKDDWRWHMYDTVKGS
DWLGDQDAIHYMTREAPAAVYELENYGMPFSRTEEGRIYQRAFGGQSLNYGKNGQAHRCC
AVADRTGHSLLHTLYGQSLRYDCNYFIEYFALDLLMDKGKCVGIIALNLEDGSLHRIKAK
NTVLATGGSGRTYFSCTSAHTCTGDGTAMVTRAGLANEDLEFIQFHPTGIYGAGCLITEG
CRGEGGYLINSEGERFMERYAPTAKDLASRDVVSRSMTIEMREGRGCGPEKDHVYLQLSH
LPQEILKSRLPGISETAMIFAGVDVTRDPIPVLPTCHYNMGGIPTNFNGQVIQHHNGKDV
IVEGLYAAGEAACASVHGANRLGANSLLDLVIFGRACALDIAAKNKPGDSIPDLPSDIGE
VSVANLDKVRFANGHTPTANLRLKMQKIMQGHAAVFRTGAVLAEGVSKIYQAYDELKDLK
LYDRGMIWNTDLVEALELQNLMLNSCQAMVSAEARKESRGAHAREDYKMRIDEFDYSKPL
EGQKKKPLNEHWRKHTLSYQNIETGKVSLDYRPVIDATLDEVECAMVPPAIRSY
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgatatctttacaaagatgctactttaaaaagtttactcagcttgctccttcatgtatt
cgtagttttcacttcacaattgaaggcagcagaacaggtgacaaaataaccaagggggaa
ttaagtcgccaatatccagtggttgatcatacatatgattgtgtagttgttggagctggt
ggagcaggtttaagagctgcttttggacttgcaaatgctggctttaaaacagcttgtgtt
acaaaactttttccaactcgttcacacacagttgcagcacagggtggtattaatgctgca
ctaggaaatatggaaaaagatgattggaggtggcatatgtatgacacagtgaaaggctca
gattggttgggtgatcaagatgcaattcactacatgactagagaagcacctgcagctgtt
tatgagcttgaaaattatggaatgcctttcagcagaacagaagaaggaagaatttatcaa
cgtgcttttggcggccagagtcttaactatggtaaaaatggccaagcgcatagatgttgt
gctgttgctgatcgaactggtcattcactacttcatactctttatggacagtcattgcga
tacgattgtaactactttatagaatactttgcattggatttgttgatggataaaggaaaa
tgtgttgggataattgcattaaatcttgaagatggatctttgcataggattaaagcaaaa
aataccgtccttgcaaccggtggttctggaagaacgtatttctcatgtacttcagcccat
acatgcacaggagatggcactgctatggttacaagagctggtcttgcaaatgaagattta
gagttcattcagtttcatcctactggtatttatggagctggttgtctcatcacagaaggt
tgtagaggagaaggaggctacttgattaatagcgagggtgaacgctttatggaaagatat
gctcctactgcaaaggatcttgcctcaagagatgttgtttctcgatcgatgacaattgag
atgagagaagggcgtggatgtggacctgaaaaagatcatgtatatttacaattgtctcat
cttccccaagagatacttaaatctcgtcttcctggaatttctgagacagccatgatattt
gctggtgttgatgtaactcgtgatcctatacctgttcttccaacttgccattacaatatg
ggtggaataccaaccaactttaacggacaggtaatacaacatcataatggtaaagatgtt
attgtggaaggtttgtatgctgcaggtgaagctgcttgtgcttcagttcatggtgctaac
cgtctgggagctaattctttgctcgatttagtcatatttggtcgtgcttgtgccttagat
attgctgccaaaaataagcctggagacagcattcctgatttacccagtgatattggtgaa
gtatctgtggccaatcttgataaggttcggtttgccaatggacacacaccaactgcaaat
ttgagattaaagatgcaaaagattatgcaaggacatgcagctgtattcaggactggtgct
gtcttggcagaaggagtgtcaaagatttatcaggcttatgatgagttgaaggatcttaag
ctttatgaccgtggtatgatatggaatacagatcttgttgaagctctggaacttcaaaat
ttaatgttaaactcctgtcaagcaatggtgtctgcagaagccagaaaagaaagtcgtgga
gcgcatgctagagaagattacaagatgcgtatagatgaatttgactacagcaaaccttta
gaaggtcagaaaaagaaacctttgaacgagcattggcgtaaacacacattgtcatatcaa
aatatagagacgggaaaggtatctcttgactatcgacctgttattgatgccactttagat
gaagtagagtgtgcaatggtaccccctgccatcagatcttattag

DBGET integrated database retrieval system