KEGG   Hydra vulgaris: 100210496Help
Entry
100210496         CDS       T01080                                 

Gene name
akt3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hmg  Hydra vulgaris
Pathway
hmg04068  FoxO signaling pathway
hmg04140  Autophagy - animal
hmg04150  mTOR signaling pathway
hmg04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100210496 (akt3)
   04150 mTOR signaling pathway
    100210496 (akt3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100210496 (akt3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100210496 (akt3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hmg01001]
    100210496 (akt3)
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100210496 (akt3)
Protein kinases [BR:hmg01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100210496 (akt3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Pkinase_C Kinase-like Haspin_kinase PH_11 Pox_M2
Motif
Other DBs
NCBI-GeneID: 100210496
NCBI-ProteinID: XP_002166833
UniProt: T2M371
LinkDB All DBs
Position
Un
AA seq 466 aa AA seqDB search
MPDEITTVKEGWLMKRGEYIKNWRPRYFVLRSNGLFLGYKEKVKGGDGGCEPINTFSIER
CQIMRQSKPKPNVFIIRCFQLTTLVERTFAVDSNFDREEWISALEEISRRLAKEEKNRRS
TSITDSTDSIHRPKMTLEDFEMLKVLGKGTFGKVMLGKEKKTGNVFAIKLLRKDVILAKD
EVEHTLTENRVLQNMKHPFLTELKYSFQTNDRLVFVMEYVNGGELFFHLSRDKVFSEARA
RFYGAEITLALKYLHENKIVYRDLKLENLLIDSEGHIKITDFGLCKEEISFTDTTKTFCG
TPEYLAPEVLEDNDYGHAVDWWGFGVVLYEMLCGRLPFYNRDHEVLFELILSEPVRFPSR
LSLSSKSILSGLLEKNPDKRLGGSIRDAEEVMSHEFFHDINWNDVLNKKLPSPFKPALDN
KEDVKYFDEDFTNETPQLTPPQGSLLDSNPNANFPEFTYAGEGKLK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatgaaattactactgttaaagaagggtggcttatgaaaagaggagaatatatt
aagaattggcgaccacgatattttgtccttcgtagtaatggtttatttttgggttacaaa
gaaaaagtcaaagggggggacggaggctgcgaaccaataaatactttttcgatagaaagg
tgtcaaattatgcgtcagagtaaaccaaaaccaaatgtttttataattagatgtttccaa
cttacaacacttgttgaaaggacttttgcagtggactcaaattttgatagggaagaatgg
atttcagcattagaagaaatttcacgacgtttagctaaagaagaaaaaaatagacgcagt
acaagcataacagattccacagattcaatacatcgaccaaaaatgactcttgaagatttt
gaaatgctaaaagtattagggaaagggacatttggaaaggttatgcttggaaaagaaaag
aagacaggaaatgtatttgcaataaagcttctaagaaaagatgtcatattagccaaggat
gaagttgaacatacattaactgaaaatcgagttttgcaaaacatgaaacatccattttta
acagaactaaagtattcatttcagaccaatgatcgtcttgtttttgtgatggagtatgta
aatggtggagagttattttttcacttgtcaagagataaagtgttttctgaagcaagagca
agattctatggtgctgagattacacttgctttaaaatatttacatgaaaataaaattgtt
tacagggatttaaagctggaaaatctcttgatagactcagagggtcacatcaaaattaca
gatttcggtttgtgtaaagaagaaatatcttttacagatacaacaaaaaccttttgtgga
acgccagaatatttagctccagaagtattagaagacaatgattatgggcatgctgttgat
tggtggggttttggagtagtactttatgagatgttgtgtggtcgactgccattctataat
cgagatcacgaagtgttgtttgaacttatattaagtgaaccagttcgatttccttctcga
ttatcactttcatcaaaaagtatactaagtggtttgttagaaaaaaatccagataaacgt
ttgggaggtagcattagagatgctgaagaagttatgtcacatgaattctttcatgatatc
aattggaatgatgttctaaataaaaagcttccttctccttttaaacctgcacttgataat
aaagaagacgtcaaatattttgatgaagactttacaaacgaaactcctcagttgacaccc
cctcagggaagtttattggatagtaatccaaatgcaaactttccggaatttacttacgct
ggtgaaggtaaactgaagtaa

DBGET integrated database retrieval system