KEGG   Hydra vulgaris: 100210535Help
Entry
100210535         CDS       T01080                                 

Definition
(RefSeq) tyrosine-protein kinase ABL1-like
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
hmg  Hydra vulgaris
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hmg01001]
    100210535
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100210535
Protein kinases [BR:hmg01001]
 Non-receptor tyrosine kinases
  ABL family
   100210535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr SH2 Pkinase SH3_1 SH3_9 SH3_2
Motif
Other DBs
NCBI-GeneID: 100210535
NCBI-ProteinID: XP_002169009
LinkDB All DBs
Position
Un
AA seq 389 aa AA seqDB search
MGQTQAKDDGSRKHKDGKPNHKRANTPGTNQEPTDKFTLPWDLRPPEKVENDESVKINDF
MRSRPLPLPPPDGDKSSQKESLNFSGIDQDKIFFVQYDFDCGDIENQLSVSKGELVHILK
YDEQKVWCEGQNKNGKTGWLPFSYVVPFTSMHKYDWYHGRISRNRAEYLLNSGINGSFLV
RESESAPGQHSLSLRYDGRVYHYRVYFENDTVYVREEAKFKTLEELVTYHSREAGGLVTN
LRYPALKVDKPAVYGFSPKDDEWEIPRMDIFMGQKLGGGQYGEVYKAEYKKYGVTVAVKT
LKEDQTDVEEFLKEADMMKQIKHPNLVRLIGVCTHESPIYIITEYMPLGNLLEYLRQSDK
ADLPATTLLYMASQVAAAMSYLESKGFIH
NT seq 1169 nt NT seq  +upstreamnt  +downstreamnt
atgggacaaacgcaggctaaagatgatgggagtcgcaagcataaagatggtaaaccaaat
cataagcgagctaacacacctgggactaaccaagagccaacagacaagtttactttgcca
tgggatttaagacctcctgaaaaagttgagaatgacgaatctgtgaaaattaatgatttc
atgagaagccgtcctcttccactccctcctccagatggtgataaaagcagccaaaaggaa
agtttaaactttagtggtattgatcaggacaaaattttttttgtacaatatgactttgac
tgtggtgatattgaaaatcaactttctgtttctaaaggtgaactggttcatatactaaaa
tatgatgaacaaaaagtttggtgtgaaggacaaaataaaaatggtaaaacaggatggctt
cccttctcatatgttgttccttttactagtatgcataaatatgattggtatcatggaaga
atttcaagaaatcgtgctgaatacttgttgaacagtggtatcaatggtagttttttagtg
cgagaaagtgaaagtgctccgggtcaacattctctttcactaagatatgatgggagggtg
tatcactatagagtttatttcgaaaacgacactgtttatgttagagaagaagctaagttt
aaaacacttgaagaattagtaacataccattctcgtgaagctggaggtcttgttactaat
ttacgatatcctgcattaaaagttgataaaccagcagtatatggtttttcgccaaaagat
gatgaatgggaaataccacgaatggatatatttatgggacaaaagttaggcgggggacag
tatggagaagtttataaggcagaatacaaaaagtatggagtaactgtagctgttaaaact
ttgaaggaagatcaaactgatgttgaagaatttcttaaagaagcagatatgatgaagcaa
ataaaacatccgaatcttgttagattaattggtgtttgtacgcacgagtcaccaatttat
attattactgaatacatgccacttggcaatcttttagaatacttgcgccagtctgacaaa
gctgacctccctgctactacacttctttatatggcgtcacaagtagcagctgcgatgagt
tatttagaatcaaaaggttttattcatag

DBGET integrated database retrieval system