KEGG   Hydra vulgaris: 100211827Help
Entry
100211827         CDS       T01080                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
hmg  Hydra vulgaris
Pathway
hmg00052  Galactose metabolism
hmg00500  Starch and sucrose metabolism
hmg01100  Metabolic pathways
hmg04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100211827
   00500 Starch and sucrose metabolism
    100211827
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100211827
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hmg04147]
    100211827
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100211827
Exosome [BR:hmg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100211827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 100211827
NCBI-ProteinID: XP_012560121
LinkDB All DBs
Position
Un
AA seq 871 aa AA seqDB search
MMYLGLGIFLLFKIFQVSTHKSICDINKNLRFDCFPESGVTEESCYSRGCCWDNSNNEGQ
PICYYGSANIGYNVCGYKETITGFTLELCLTGLGGHYGKNVLKLNANFYLETDNTLHVKI
FDPYNKRYEVPTPSPNVKNKATSLNYHVTYTNDLFSFKVVRISNGEVIFDSNVGGFIFSD
QFIQISSILPSDNIYGLGEHVLGLKLSTDWNLLTLFSRDIPTPEGGVNLYGVHPFYVNIE
KTGLANGVFLKNSNAMDIILQPTPAITYRTIGGILDFYIFLGPTVNDVVSQYTKIVGRPI
MPPYWSLGFHLCRWGYNSLNEMNAVRNRMAANQIPQDVQWNDIDYMDNFRDFTIGYSFKG
LNRFVDNLHDQGMHYVIMLDPALSINYHGYLPYDEGIKENIFIKNSKGEVLVGAVWPGLA
AFPDFTHPNISNYWLMQIKSFHEKLQFDGLWIDMNEPSSFVDGSSKGCPKNAYDQPPYTP
AIIGGTLFQKTLCMNSQQYGGSHYNLHSLYGHLESKVTMSSLQKIRGKRSFVISRSTYSG
TGVYAGHWLGDNHSTWEDLYKSIAGIINFNLFGIPLVGADICGFSGDTTEELCSRWMQLG
AFYPFSRNHNDHESRSQDPAAFGEMLIIASRNALNTRYQLLPYLYSLFFEAYVNGTPVAR
GLFSEFPTDSNCLNNDKQFMWGKGLLISPVILEGAVNVRAYLPAGFWFNFYTGELFDSQG
EYVNLPASYEYVNLHIRGGLIIPTQDSAITTTKSRENDFGMIVALNNDGKANGFLYLDDG
EQILEENLEKSSVIEFHSHQGEFYSIPLYNKFFPNHTTFSKISIYGVIVEPTQVNVNGKA
FLFKYDKNLKVLGISDMGLSILEENHIKWSA
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgatgtatttaggacttggcatatttctcttgtttaaaattttccaagtatcaacacat
aaatcgatttgcgatatcaacaaaaacttaagatttgactgttttcctgagagtggagtt
acagaagaatcttgttatagtcgaggatgttgttgggacaattcaaataatgaagggcaa
cctatctgttattatggatcagcaaatataggttacaatgtttgtggttacaaagaaact
attacaggatttaccttggaactatgtctaactggactaggaggacattacggaaaaaat
gttttaaaacttaatgctaatttttatttggaaacagataacacgttgcatgtcaagatt
tttgatccttataataaaagatatgaagttcctaccccttctcctaatgtaaaaaataaa
gcaacatctctgaactatcatgtaacctatacaaatgatttgttcagcttcaaagttgtt
agaatatcaaatggagaagtcatatttgactcaaatgttggtggctttatattctctgat
caatttattcaaatatcttctattctaccatctgacaacatttatggtttgggtgaacat
gttttaggtttaaaattgagcacagactggaatcttcttaccttattttctagagacatt
ccaactcctgagggtggagtgaacttgtatggagttcatcctttttatgttaacattgag
aaaactggcttggctaatggagtttttttgaaaaacagcaatgcaatggatataatattg
cagcctacaccagcaataacatatagaacaattggtggaattttggacttttacattttt
cttggaccaacagttaatgatgttgtttcccaatacactaagattgttggccgtccaata
atgccgccttattggtcattaggatttcatttatgccgttggggatacaattctttaaat
gaaatgaatgcagtcagaaatcgaatggcagctaatcaaattcctcaagatgttcaatgg
aatgatattgattatatggataactttcgtgattttacaataggttacagttttaaaggt
ttaaatagatttgtagacaatcttcatgaccaagggatgcattatgttattatgttggat
ccagcattaagtatcaattaccatggttacttaccttatgatgaaggaataaaagaaaat
atattcataaaaaatagtaaaggggaagtattagttggtgctgtttggcctggattggct
gcttttcctgattttacacaccccaatatttcaaactactggcttatgcagatcaaaagt
ttccatgaaaaacttcaatttgatggattgtggattgacatgaatgaaccatctagcttt
gttgacggatcatcaaaagggtgtccaaaaaatgcctatgatcagccaccctatactcct
gctataattggtggaacactttttcaaaaaactttatgcatgaattcacaacaatatggt
ggaagtcattacaacttgcatagtttatatggccatttagagtcaaaagtaaccatgagt
tctttacaaaagatacgtggtaaacgctcatttgtgatttctcgttcaacatattctggg
actggtgtttatgcaggacactggctaggtgataatcacagcacatgggaagatctttac
aaatcaatagcaggtataataaattttaatttgtttggtattcctttggttggagcagac
atatgtggattttcaggagatactacagaagagctttgcagcagatggatgcagctggga
gcattttaccctttctctaggaaccataatgatcacgaatctagatctcaagatcctgca
gcatttggtgaaatgttaattattgcttcacgaaacgcattaaatacacgataccagctg
ttaccatatctttactcgttattttttgaggcttatgtaaatggtacacctgtagcgagg
ggattattttctgaatttccaacagatagtaactgtctaaacaatgataaacagtttatg
tggggaaaaggccttttaattagccctgtgattttggagggtgcagtgaatgtgagagca
tatctaccagctggattttggtttaacttttacactggtgagttgtttgatagtcaaggt
gagtatgtgaatcttcctgcttcttatgaatatgtgaatttacatatcagaggaggtttg
attatacctactcaagattctgctattacaacaacaaaaagtcgtgaaaatgattttggc
atgattgtggcattaaataatgatgggaaagcaaatggttttctttatcttgatgatggt
gagcaaattctagaagaaaatctagaaaaaagctccgttattgagtttcattcccatcag
ggagaattttattcaattcctttgtataacaaattttttcctaatcatactacattctct
aaaatctctatttatggggtgattgtggaacctactcaagttaatgtcaatgggaaagct
tttttattcaagtatgacaagaatctaaaggtacttggaattagtgatatgggcttatct
attttggaagaaaatcatataaaatggtcggcttaa

DBGET integrated database retrieval system