KEGG   Hydra vulgaris: 100212685
Entry
100212685         CDS       T01080                                 

Definition
(RefSeq) caspase-3-like
  KO
K04489  caspase 3A [EC:3.4.22.-]
Organism
hmg  Hydra vulgaris
Pathway
hmg04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    100212685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hmg01002]
    100212685
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     100212685
Peptidases and inhibitors [BR:hmg01002]
 Cysteine peptidases
  Family C14: caspase family
   100212685
SSDB
Motif
Pfam: Peptidase_C14 UPF0158 FAST_1
Other DBs
NCBI-GeneID: 100212685
NCBI-ProteinID: NP_001274721
UniProt: Q9GV89
LinkDB
Position
Un
AA seq 347 aa
MSNVNIYGSVTAVNISNNGSQKEVPIPFIPTTKNLFPHSNEQFLQKSILKIDDWFPDWLL
EETKKENELAEKAFESVVNAIREKDFYYTLSTGFVLIINNEKFVEEENRDGSEVDVQALN
SFFKGTLGWCVKSCNNLKREDIINIVYSLSQVKCFPFSALFIVILSHGSESGILGIDSSE
EIKINSLLENFKADNAPAFDKKPKVFIVQACRGEKDDIRKDGIKDAKRTYYNESTIPMLS
DFVVAYPCAAGYTALRSTVKGSWFIQELVKCLSIFYDKEDFLSILNRVNFKVANVTLPQG
LKEQPCFEVGLRTRCFFQEYFRKLHNILEYYSSLNSDTKKLLIKGDF
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgtctaatgttaatatttatggttctgtaactgctgtaaatatttcaaataatggttct
caaaaagaagttcctattccattcattcctacaacaaaaaatttatttccgcattccaat
gaacagtttttacagaaaagtattttaaagatagatgattggtttcctgattggttatta
gaagaaaccaaaaaagaaaatgagttagcagagaaagcattcgaatcagttgtgaacgca
attcgtgaaaaagatttttattacacattaagtactggttttgtattgatcatcaacaac
gaaaaatttgttgaggaagaaaatagagatggctcggaagtagacgttcaagctttaaac
tcttttttcaaaggtactttaggttggtgcgtaaaatcctgtaacaacctgaaaagggaa
gatattattaatattgtgtattctctctctcaagtaaagtgttttccattctctgcgtta
tttatcgttattttatctcatggatcagaatctggaatacttggcatcgattcatctgaa
gagataaaaatcaacagtctgcttgaaaactttaaagctgataatgctcctgcctttgat
aaaaaacctaaagtttttattgtacaggcatgcagaggggaaaaagatgatatcagaaaa
gatggtataaaagatgctaaaagaacttattataatgaatcaaccattcccatgttaagc
gattttgttgttgcttacccatgcgcagcaggatacactgctctaagatcaacagtaaaa
ggttcgtggtttattcaagagttggttaaatgtttgtcgatattttacgataaagaagac
tttttatctattttgaatcgggtaaatttcaaagttgcaaacgttacgttgccacaaggt
ttaaaagaacagccttgttttgaggttggtttgcgcacgcgatgtttttttcaagagtat
ttcagaaaattacataatattttagaatattacagttcgttaaactccgatacaaaaaag
ttactaattaaaggtgatttttaa

DBGET integrated database retrieval system