KEGG   Hydra vulgaris: 100215837Help
Entry
100215837         CDS       T01080                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
hmg  Hydra vulgaris
Pathway
hmg00040  Pentose and glucuronate interconversions
hmg00051  Fructose and mannose metabolism
hmg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100215837
   00051 Fructose and mannose metabolism
    100215837
Enzymes [BR:hmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     100215837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Methyltransf_16 ADH_zinc_N_2 ThiF
Motif
Other DBs
NCBI-GeneID: 100215837
NCBI-ProteinID: XP_004207543
LinkDB All DBs
Position
Un
AA seq 349 aa AA seqDB search
MEQDNLSLVLYGPDNMKLEQRPVPKPGKNEVLLAMQCVGICGSDVHYLKHGRIGDFVVTK
PMVLGHEGSGVVTQVGEGVTHLKVGDRVAIEPGIPCRNCEFCKSGKYNLCSDIFFCATPP
DDGNLCRFYTHAADFCYKLPDHVTLEEGALLEPLSVGVHSCRRAGVAVGDKVLILGAGPI
GLVTLLVAKAAGASQIAITDIDEGRLEMAKKFGVDKAFKVTSRDGKEVANMIINEFGQAN
KTIECTGVESSIQTGIFCTKSAGVLVVVGMGKAEVTLPIVNALVREVDVRGIFRYANCYP
AALELVSSGKVDVKPLITHRFTLEQSADAFAMSASQSDGAIKVMISCHQ
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagataacttgtcattggttttatatggacctgataatatgaagcttgaacaa
agacctgtgccaaagcctgggaagaatgaagtacttcttgcaatgcaatgtgtcgggatc
tgtggatcagatgtacactatcttaagcatggcagaattggagattttgtggtcaccaaa
ccaatggtacttggtcatgaaggaagtggagttgttacacaagttggagaaggagtcact
catttaaaagttggtgaccgagtggctatagaacctggcattccttgtcgaaattgtgag
ttttgcaaatctggaaaatataatttatgcagtgatatctttttctgtgcaactccacct
gatgatggaaatttatgtcgattttatactcatgcagcagacttttgttataaacttcca
gatcatgtaacattagaagaaggggcattattggaaccactttcagttggtgttcattcc
tgtagaagagctggtgtggctgtcggtgataaagttttaatattgggagctggtcctatt
ggtctagtaactctattagttgcaaaggctgctggagcaagtcaaatagctattacagat
atagatgaaggacgtttagaaatggcgaaaaaatttggtgttgataaagcatttaaggta
acttcacgagatggaaaagaggttgcaaacatgattataaatgagtttggccaagccaat
aaaaccatagaatgtactggtgtagaatcaagtatacaaacaggaattttttgcactaaa
tctgctggtgttcttgttgttgttggcatgggtaaagcagaagtgactcttcccattgtc
aatgctttagttagagaagttgacgtaagaggaatatttcgctatgccaattgttatcct
gccgctttggaattagtatcttctggaaaagtcgatgtaaaacctcttattacacaccga
tttactttggaacaatctgctgatgcttttgctatgtctgcatctcaaagtgatggcgca
ataaaagtgatgatttcgtgccatcaataa

DBGET integrated database retrieval system