KEGG   Hydra vulgaris: 101238155
Entry
101238155         CDS       T01080                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
hmg  Hydra vulgaris
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hmg04052]
    101238155
   00536 Glycosaminoglycan binding proteins [BR:hmg00536]
    101238155
Cytokines and growth factors [BR:hmg04052]
 Growth factors
  Growth factors (RTK binding)
   101238155
Glycosaminoglycan binding proteins [BR:hmg00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101238155
SSDB
Motif
Pfam: FGF Fascin MTES_1575
Other DBs
NCBI-GeneID: 101238155
NCBI-ProteinID: XP_004209541
LinkDB
Position
Un
AA seq 184 aa
MILLQSFFEKTLLIFVVVKLSQPVPTLMPRNVKLSLIKDEMVKYLKHPSYKKSVLLYSKQ
GYFLSIADDGKIYGTHDGFSPDAQLEVQSFGVNFKRIRKPGSWYLSIDKNGAVKAENDPK
NETLFQEVIDKEGWAIYRNDLTGYLLAFNKNGKLQQNLKSSKVKNKAKFLLLSSFSSGGK
KQKA
NT seq 555 nt   +upstreamnt  +downstreamnt
atgatattgcttcaaagtttttttgagaagacacttttaatttttgttgttgttaaacta
tcgcaaccagtgccgaccttgatgccaagaaatgtaaaactttctttaataaaagatgaa
atggtaaaatacctaaaacatccttcttataaaaaaagcgtactgctctattcaaagcaa
ggttattttttatcgatagcagacgacgggaaaatatatggaactcatgatggattttca
cctgatgctcagctagaagtacagtcatttggagtgaactttaaacgtataagaaaacct
ggctcatggtatctatcaattgataaaaatggcgcagtaaaagctgagaatgatccaaaa
aacgaaactttattccaagaagtaattgataaagaaggttgggcaatataccgtaatgat
ttaactggatatctactagcatttaataaaaatggaaaattacaacaaaacttgaagagc
tctaaagtaaaaaataaagcaaagtttttacttctttcttcattttctagtggtggaaaa
aagcagaaagcataa

DBGET integrated database retrieval system