KEGG   Hydra vulgaris: 101239383Help
Entry
101239383         CDS       T01080                                 

Definition
(RefSeq) fanconi-associated nuclease 1-like
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
hmg  Hydra vulgaris
Pathway
hmg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    101239383
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hmg03400]
    101239383
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     101239383
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     101239383
DNA repair and recombination proteins [BR:hmg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     101239383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VRR_NUC
Motif
Other DBs
NCBI-GeneID: 101239383
NCBI-ProteinID: XP_012557644
LinkDB All DBs
Position
Un
AA seq 907 aa AA seqDB search
MTSTDKKKCSKLKQNSACPACGIQIDKQKINRHLDAECVSAKNLHKFYIDEDFLVIKSNN
DKKKDFRTDSKIYDKISNSALLNINQGSENNSLFSSSSLDTTNLKNSLAKKKPSYEVLVI
DDDDDDGDDHNNGCNKSKKISSNKKKSLVIPVKKLSFSSDQWKSKLKNLAEKLSEFSNKH
IIFEESCIKEWRKELNPFRLFGLNSHQNQKLFETVKESSKINKNLVFEEVHGISNNLIEE
DKHKMELIRAIDIKKFNVSPPYYLQNFIYIIEKVLQSNDIFTLFELKDVKVLAKCKDLSQ
LSLQLYVRLYLRKKGWFRCSKIQYPDISTDLNGFIDDLITNEYLTDGKHLNNLDEVLHLL
NANEVRQLSKEFHLVKCGTMLSKKDLCCMLKKHCLQQKSLFKNNDSSLSSLMSKKAKEYL
GRCVKLNEEVAFVFTRIFTLFSITTTHYEDVMYFTGYNEIYHLLQVNNCEVKYPLYTINK
KSRLFTSCDELTSYVVAAENERELDLFMEKKDFDAAYGIYTKVKPRFISICEELLDEEKR
KVIRCFSLPYFLSCYSEPWILFRICSKSVELLEKRQEYLEAVLLLELLLSQNYFGNCSRG
ALWDRLIIDTERYLKDLPKVVLLIKTALNDPFVRTGHRLSLLQRYQRLKNSPRCKKMIFD
NSLLNDILQFNEFREEILCAEIFLEGSSTQRTVFKNISGEEQSMSHVEQFVLDHYKEKGF
PNGLHGEGSVVTTLFLLLFWDIIFMDVEDAFHSDFQCSPLDMYRDCFYSNRKDAIDKKLN
WLQSLPDPELRSAVEISWDKNYGTNAVGVKWDMFQNATDAGDLAVCLGSKLLSGISELFC
KDFRRRRGGFPDLVLWNIKTKGCKIIEVKGPGDKLSTKQLVWLNVLTYLGADAFVCYVKG
GGKRKRE
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgactagcactgataaaaagaaatgttcaaaattgaaacaaaactctgcttgtcctgca
tgtggaatacagatagataaacaaaaaatcaatcgccatcttgatgctgaatgtgttagt
gcaaaaaatttacacaaattttatatcgatgaagatttccttgtaataaagtcaaataat
gataaaaaaaaagatttccgaactgatagcaaaatttatgacaaaattagcaactctgcg
ttactaaatataaaccaaggttctgaaaataacagcttgtttagttcttcatcattagat
acaacaaatttaaaaaattctttggctaaaaaaaaaccaagctatgaagtacttgttatt
gatgatgatgatgatgatggtgatgatcataataatggttgtaacaaatctaagaaaatt
tcatcaaataaaaaaaagagtttagttatacctgttaaaaaattatcattttcctctgat
caatggaaatcaaaacttaaaaatttagcagaaaaactgtctgagttcagcaataagcat
attatttttgaagaaagttgtattaaagaatggagaaaggagttgaatccgtttcgatta
tttggtctgaatagtcatcaaaaccaaaaattgtttgaaacagttaaagaatcatcaaaa
ataaataaaaacttagtttttgaagaagttcatggcatttcaaacaacttaattgaagaa
gacaaacataaaatggagttaattagagctattgatattaagaaatttaatgtttctcca
ccatattatttgcagaacttcatttatataattgaaaaagttcttcaatctaatgatatt
tttactttatttgaattaaaggatgttaaagttcttgcaaaatgcaaagatttgtcacaa
ttatctttgcagttatatgttcgtttgtatcttagaaaaaaaggatggttcagatgcagt
aaaatacaatatccagacattagtactgatttaaatggattcattgacgatcttattaca
aatgaatatcttactgatggcaagcatcttaacaacctagatgaagttctacatctttta
aatgcaaatgaagttcgtcaattgtcaaaagaatttcatttagtaaaatgtggaactatg
ttgtctaaaaaagatctttgctgcatgttaaagaagcactgtttgcaacaaaaatcattg
tttaaaaataatgattcatcattatcatctctaatgagcaaaaaagcaaaagaatatctt
ggtcggtgtgtgaaacttaatgaagaagtagcatttgtatttacacgaatttttactctc
ttcagtatcacaactacccattatgaagatgttatgtactttacaggatacaatgaaata
tatcacttgcttcaagtgaacaattgtgaagttaagtatcctttgtacacaataaataag
aagagtagattgtttaccagttgtgatgaactgacttcatatgtagttgctgctgaaaat
gagagagaactggacttgtttatggagaaaaaagattttgatgctgcctatggaatttat
acaaaagtaaaacccagatttatcagtatttgtgaagaattgcttgatgaagaaaaaaga
aaggttattcgatgtttctcactaccctattttctttcctgttattcagagccatggata
ttgtttcgtatttgtagtaaatcagttgaactacttgaaaaacgccaagagtatttggag
gcagttttattgctggagttgctgctgtctcaaaattattttggtaattgttcaagaggt
gcattatgggatcgcttaattattgatacagaacgttatttaaaagatcttcctaaggta
gtgttactgataaaaactgcactgaatgatccttttgttcgcactggtcatagattatct
ttgcttcaacgatatcagcgtctaaaaaactctccaagatgcaaaaaaatgatttttgat
aacagtcttcttaatgatattttgcagttcaatgaattccgagaagagatactatgtgca
gaaattttcttagaaggttcttcaactcagcgaacagtttttaaaaatatatcaggtgaa
gaacaatcaatgtctcatgtagagcagtttgtgttagaccattataaagaaaaaggtttt
cctaatggtcttcatggtgaagggagtgttgttacaacattgtttcttttacttttttgg
gatattatcttcatggatgttgaggatgcatttcatagtgattttcaatgttccccactg
gatatgtatcgtgattgtttttattcaaacagaaaggatgcaattgacaaaaaacttaat
tggttgcagtctttaccagaccctgagttgcgaagtgcagtcgaaatttcatgggataaa
aattatggaacaaatgctgttggcgtaaaatgggatatgtttcaaaatgctactgatgct
ggtgaccttgcagtgtgtcttggctcaaagcttctttctggaatatctgagttattttgc
aaagactttaggcgtcgaagaggggggtttccagatcttgttctttggaatataaagact
aaaggttgtaagataattgaagtgaagggaccaggcgataaactttcaacaaaacaactt
gtatggctgaacgtactgacatatttgggcgctgatgcatttgtatgttatgttaaaggc
ggaggtaaacgcaaacgagaatga

DBGET integrated database retrieval system