KEGG   Hydra vulgaris: 105844255Help
Entry
105844255         CDS       T01080                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
Organism
hmg  Hydra vulgaris
SSDB OrthologParalogGFIT
Motif
Pfam: CDI PFEMP
Motif
Other DBs
NCBI-GeneID: 105844255
NCBI-ProteinID: XP_012556135
LinkDB All DBs
Position
Un
AA seq 127 aa AA seqDB search
MLERESIYYLRTRKVKRMLWPVDHERILSDLKNEEIRIKKEFTEKYNFDFDTEKPMHGKY
NWISISSETYNENSNFKEDPPCCSNVEKNDKLRNTSKKRKDKSKNSMTVPKKKRISPSSM
TLRRGNV
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgttagagagagaaagcatatattatttacgcactcgtaaagttaaacgaatgctttgg
ccagttgatcatgaaagaattctttcagatttgaagaacgaagagattagaattaaaaaa
gagtttactgaaaagtacaactttgactttgatactgaaaaaccaatgcatggtaaatat
aattggatatccataagttcagaaacgtataatgagaattctaattttaaggaagacccc
ccttgttgttctaacgtcgaaaaaaacgataaattaagaaatacatccaaaaaaagaaaa
gataaatctaagaacagcatgacagttcccaagaaaaagagaatatctccgtcaagtatg
acgttacgtagaggtaatgtttaa

DBGET integrated database retrieval system