KEGG   Hydra vulgaris: 105844255
Entry
105844255         CDS       T01080                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
hmg  Hydra vulgaris
Pathway
hmg04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105844255
SSDB
Motif
Pfam: CDI PFEMP
Other DBs
NCBI-GeneID: 105844255
NCBI-ProteinID: XP_012556135
LinkDB
Position
Un
AA seq 127 aa
MLERESIYYLRTRKVKRMLWPVDHERILSDLKNEEIRIKKEFTEKYNFDFDTEKPMHGKY
NWISISSETYNENSNFKEDPPCCSNVEKNDKLRNTSKKRKDKSKNSMTVPKKKRISPSSM
TLRRGNV
NT seq 384 nt   +upstreamnt  +downstreamnt
atgttagagagagaaagcatatattatttacgcactcgtaaagttaaacgaatgctttgg
ccagttgatcatgaaagaattctttcagatttgaagaacgaagagattagaattaaaaaa
gagtttactgaaaagtacaactttgactttgatactgaaaaaccaatgcatggtaaatat
aattggatatccataagttcagaaacgtataatgagaattctaattttaaggaagacccc
ccttgttgttctaacgtcgaaaaaaacgataaattaagaaatacatccaaaaaaagaaaa
gataaatctaagaacagcatgacagttcccaagaaaaagagaatatctccgtcaagtatg
acgttacgtagaggtaatgtttaa

DBGET integrated database retrieval system