KEGG   Hydrocarboniclastica marina: soil367_03690Help
Entry
soil367_03690     CDS       T06192                                 

Definition
(GenBank) histidine kinase
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
hmi  Hydrocarboniclastica marina
Pathway
hmi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hmi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    soil367_03690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hmi01001]
    soil367_03690
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:hmi02022]
    soil367_03690
   02035 Bacterial motility proteins [BR:hmi02035]
    soil367_03690
Enzymes [BR:hmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     soil367_03690
Protein kinases [BR:hmi01001]
 Histidine kinases
  NtrC family
   soil367_03690
Two-component system [BR:hmi02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   soil367_03690
Bacterial motility proteins [BR:hmi02035]
 Pilus system
  Twitching motility proteins
   soil367_03690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA HATPase_c PAS PAS_8 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: QCF25111
UniProt: A0A4P7XE13
LinkDB All DBs
Position
complement(807836..809491)
Genome map
AA seq 551 aa AA seqDB search
METKAHQPEPAPTVEIAPGQIQRHQKTRLFRVYNHYRLAISLVLVMLLIVDLEALQPQYR
FPAFYQALVLGYFGLNAFIGFMLLAGFQPHSRHTTVSVLVDLLVLHGMLFFSSGITSALA
NLIIISVAAGNILNPTRLGFFFAALAAIGSLALAGWDAMVIGGGNTGDDIVRAGFLGILY
FGVAFVLQNITRRLIFSEALASERAESIAALERLNHQIIQRMRTGIIVADPQGEVKLANE
AAGELLLGERRASRDLERLPTPLQERLERWFAQPSHRTEPFQVDIASPMLQANFTRLEQE
SDDRLLIFLDDTSKITQQAQQLKLASLGRLTAGIAHEVRNPLGAISHAAQLLAESDALNG
PDRKMLDIIQRHAARVNTIIENVLELSRRRQPDARVHDLYLWTLERVTHYQNDCDQHSDI
SLEPGSHRPQARFDSSQMEQVLTNLIDNGLRYSEQETGARALDMSIGMAEDGERAYLDIR
DRGPGISESQRASIFEPFYTTERTGTGLGLYLARELCEANQAQLALIDAGPGGCFRITFA
HPQRQSLNASL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagcgcaccagcccgagcccgccccaacggttgagatcgcgccgggccag
attcaacgtcatcaaaaaacgcgcctgttccgcgtttataaccattaccggctagccata
agcctggtcctggttatgttgctgatagtcgaccttgaagcgcttcagccgcagtaccgg
ttcccggcgttctaccaggcacttgttctcggctatttcggtttgaatgcctttatcggt
ttcatgctcctggccggttttcagcctcactcccgccacacgacagtgtctgtgctggtg
gacctgcttgtgctgcacggcatgctgttcttcagcagcggtataaccagcgctctggcc
aacctgattatcatctcggtcgccgccggcaacattctcaaccccacccgactgggcttc
ttttttgcggcgctcgccgcaatcgggtcgctggccctggccggatgggacgcaatggtc
attggcggcggcaacaccggcgacgacattgtcagagcgggctttctcggcattctctac
ttcggcgtagcgtttgtacttcagaacattacccgccgactgattttcagcgaggcgctt
gcaagcgagcgggccgagagtattgcagcgctggagcggctcaaccaccagatcatccag
cgcatgcgcaccggcattatcgtggctgacccccaaggcgaggttaagctggccaacgaa
gccgccggtgaactgctgctgggcgaacgtcgagcctcacgggacctggagcgcctgcca
acgccgctgcaggagcgcctcgaacgctggtttgcgcagccctcccatcgcaccgaaccg
tttcaggtcgacatcgccagccccatgctccaggccaattttacccggctggaacaggag
tccgacgatcgtttgcttatattcctcgatgacaccagcaaaatcacccagcaggcccag
cagctcaaactcgcctcccttggccgacttacagcaggcatcgctcacgaggtccggaac
ccgttgggcgctatcagccacgccgcccagctcctggccgaatccgatgcgctgaacggg
ccggaccggaaaatgctcgacatcatccagcgccacgccgcgcgggtgaataccattatc
gagaatgttctggagctctcgcgccggcgtcaacccgacgcccgggttcatgatctttat
ctatggacgctcgaacgcgtcacgcactatcagaacgactgcgaccagcacagtgacatc
agcctggaacccggcagtcaccgcccccaggcgcgcttcgacagctctcagatggagcag
gtgttaacgaacctgatcgacaatggcttgcgttatagtgaacaggaaaccggcgcgcgc
gcgctggatatgagtatcgggatggcagaggacggtgaacgggcttatctcgacattcgc
gaccgcggtccgggcatatcggagagtcagcgggcgtctatattcgagcccttctatact
acggagagaacaggaaccgggctgggcctctacctagcccgggagctctgcgaggcaaac
caggcgcaactcgcactgatcgatgcaggtccgggcggctgttttcggatcacgtttgcc
catccccaaagacagagcctgaacgcgtcgctgtaa

DBGET integrated database retrieval system