KEGG   Hydrocarboniclastica marina: soil367_14690Help
Entry
soil367_14690     CDS       T06192                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hmi  Hydrocarboniclastica marina
Brite
KEGG Orthology (KO) [BR:hmi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    soil367_14690
Enzymes [BR:hmi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     soil367_14690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_3 FAD_binding_2 HI0933_like AlaDh_PNT_C Glutaredoxin FAD_oxidored NAD_binding_7 Thi4 DAO K_oxygenase NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: QCF27079
UniProt: A0A4P7XIZ6
LinkDB All DBs
Position
3297870..3299435
Genome map
AA seq 521 aa AA seqDB search
MLDANLKNQLKGYLEKVTQPFEIVASLDDGDKSRELQELLQEIEELSRHITLRTDGDDAR
KPSFSLNRPGDNISLRFAGIPMGHEFTSLVLALLQVGGHPSKAGQDVIEQVKNVEGEFNF
ETYFSLSCQNCPDVVQALNLMATLNPNIRHVAIDGALFQDEVEERQVMAVPTVFLNGETF
GQGRMGLEEILSKIDTGASAREAEKLNAQAPYDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTNAIENFTSIRETDGPKFAQALEEHVKDYDVDIMNLQRAVKLVPAGEKGG
LNEVQFASGASLRAKTLILSTGARWREMDVPGEAEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEYDSQLRADDVLQRKLRSLKNVDVITSALTSEVKGDG
KKVTGLTYKDRNSSEFHSLDLEGIFVQIGLLPNSDWLKGTVELSPRGEIIVDSRGATSLP
GVFAAGDVTTVPYKQIVVATGDGAKAALSAFDHLIRTSAPE
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatctgaaaaatcaactgaaaggttacctggagaaagttacccagccc
tttgagatcgtcgcgtcccttgatgacggcgacaagtcccgggagttgcaggaacttctt
caggaaattgaagaactttcaagacatattactctgcggaccgatggcgatgatgcacgc
aagccttcgttctcgctgaaccgtccaggggataacatcagcctgcgtttcgccggcatc
cccatgggccacgaatttacctccctggtcctggcactgctgcaagttggcggccatccg
tccaaggccggccaggacgtaatcgaacaggtcaagaatgtagaaggtgagttcaacttc
gaaacttacttctcgttgtcctgccagaactgcccggatgtcgtccaggcgctgaacctt
atggcgaccctcaacccgaacatacggcatgtcgcgattgatggcgcgctgttccaggat
gaagtggaagaacgccaggtcatggcggtaccgacggtcttcctgaacggggaaaccttc
ggccagggccgcatgggcctcgaggagatcctgagcaagatcgacaccggcgcctccgcc
cgggaagccgagaagctcaacgcccaggcgccttacgatgtgctcgtcgtcggcggtggc
cccgcgggcgcttctgccgccatctatgcggcgcgcaaaggcatccgtaccggcgtcgca
gctgaacgctttggcgggcaggtactcgacaccaacgccatcgagaacttcacctcgatc
cgcgaaacggacgggcccaagtttgcccaagcgctggaagagcacgtcaaggactacgac
gtggacattatgaacctgcagcgggcggtcaaattagtgcctgccggagaaaaaggcggt
ctgaacgaagtccagtttgcgtccggcgcctctctgcgagccaagacactgattctctcg
accggcgcccgctggcgcgagatggacgtgccgggcgaggctgagtaccgcaataaaggt
gtggcctattgcccgcactgcgacggtcccttgttcaagggcaagcgcgttgcggtcatt
ggtggtggtaactccggcgttgaggcggccattgatctggcgggcatagtagctcacgtc
acgctgatcgagtacgacagccagcttcgggctgacgatgtgctccaacgcaagctacgc
agcctcaagaatgtcgacgtcattaccagcgccctgaccagcgaagtcaaaggtgacggc
aaaaaggtgacaggtctgacctacaaggaccgtaactccagcgagttccattcgctggac
ctggagggcatcttcgtccagatcggcctgctgcccaacagcgactggctgaaaggaacc
gtagagctgtcaccccggggcgaaatcatcgtcgattcccgcggcgccacctcactgccc
ggcgtttttgcagccggtgacgtcaccaccgtgccctacaagcagattgtggtggctacc
ggcgacggcgccaaggcagcactcagcgcgtttgaccacctcatcagaacgtccgccccc
gagtaa

DBGET integrated database retrieval system