KEGG   Haematobacter massiliensis: HmaOT1_00535Help
Entry
HmaOT1_00535      CDS       T05861                                 

Definition
(GenBank) hypothetical protein
Organism
hml  Haematobacter massiliensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_Capsid_P3
Motif
Other DBs
NCBI-ProteinID: QBJ22880
LinkDB All DBs
Position
pOT1-7:13182..14042
Genome map
AA seq 286 aa AA seqDB search
MTNRFDISKAPLRAEPRHPAAAAPVQSVPATPGGLIRSTLLAAGAAGAILVLFWLPAEYG
IDPTGVGALTGLTEMGEIKQQLAGEAAADAQAAAAAPVAAVEATPATAAPAPEILARLDR
IDAQLAAISAVIGTPPGLTEAAEAAPVAAEPAPDAAATPAPDPVDAAVAEAAALEPTAEP
ATPEWRDEVSYTLNPGEGIEVKLSMEEGQTARFFWTANGSVVNFDLHGDGSGQKISYEQG
RAIPDAAGDLTAAFTGNHGWFWRNRTEAPVTVTLRTGGDYAEIKAP
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccgtttcgatatctcgaaagcccccttgcgggccgaaccccgccaccctgcg
gcggccgcacctgtccagtcggttccggccacgccgggcgggctgatccggtccaccctg
ttggccgccggcgcggcaggggcgatccttgtcctgttctggctgcccgccgaatacggg
atcgacccgaccggggttggtgccctgaccgggctgaccgagatgggcgagatcaagcag
cagcttgctggggaagccgcggctgatgcacaggcagccgcagcggcgcctgtcgccgcc
gttgaagccacgcctgccacggccgcccccgcgcctgaaatcctcgcgcggcttgaccgg
atcgacgcccagcttgcggccatctctgccgtgatcggcaccccgccaggcctgaccgag
gccgcggaagcggccccggtcgcggcagagccagcgcccgacgcggcggcaacacctgcg
cccgacccggtcgacgccgctgtcgccgaggccgccgctctggaaccgaccgccgaaccc
gccacccccgaatggcgcgacgaggtcagctacaccctgaaccctggcgaggggatcgag
gtgaagctctccatggaggaaggccagaccgcccggttcttctggacggcgaacggcagc
gtggtgaactttgatcttcacggcgacggcagcggccagaaaatcagctatgagcaaggt
cgcgccattcccgatgccgcaggcgacctcactgccgccttcaccggcaaccatggctgg
ttctggcgcaaccgcaccgaggcgccggtcaccgtgaccctgcggactggtggggattac
gcagagatcaaggccccgtag

DBGET integrated database retrieval system