KEGG   Halobacillus mangrovi: HM131_02060Help
Entry
HM131_02060       CDS       T04799                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hmn  Halobacillus mangrovi
Brite
KEGG Orthology (KO) [BR:hmn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HM131_02060
Enzymes [BR:hmn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HM131_02060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored FAD_binding_3 Thi4 DAO AlaDh_PNT_C Glutaredoxin Thioredoxin_4 NAD_binding_8 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ARI75684
UniProt: A0A1W5ZQW4
LinkDB All DBs
Position
complement(383557..385086)
Genome map
AA seq 509 aa AA seqDB search
MVLDAQIKAQLNQYLDLMEGDVVLKVSAGDDDVSKEMLGLTDELVSMSPRITTENAQLKR
TPSFSVNRPGEDTGITFAGVPLGHEFTSLVLALLQVSGRAPKADQSVIDQISNISGEFHF
ETYVSLSCHNCPDVVQALNLMSVLNPNITHTMIDGAAFKDEAENNNVMAVPSVYVNGKFF
KGGRMTLEEIIGEIADGPDPDEFNNKDPYDVLVVGGGPAGSSAAIYTARKGIRTGVVAER
FGGQVQDTLSIENFISVKKTEGPKMVASLEEHVKDYNIDVMNLQRASRLEKKDMFELELD
NGGVLKSKSVILSTGARWRQLGVSGEAEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFGAELKADEVLQERVNSLPNVTVITNAQTTEITGDENVNGLTY
IDRATNEEKHIELEGVFVQIGLVPNTEWLGDTVERTRTGEIVVDKHGATNVPGLFAAGDC
TDSPYNQIIISMGDGANAALGSFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggttcttgatgcacaaattaaggcccaattaaaccaatatttagatttgatggagggc
gacgttgtactgaaagtcagtgctggagacgacgatgtctctaaggagatgctcggtctt
accgatgaacttgtctccatgtcccctcgcattaccacagaaaacgcacaactaaaacga
acacctagtttcagcgtgaaccgtcctggtgaggacactggcattacatttgctggtgtt
ccgctgggccatgaattcacttccctcgtccttgctctcttgcaagtgagcgggcgagcg
ccaaaagcagatcaaagcgtaatcgaccagatctccaacatcagcggcgaatttcatttc
gaaacgtacgtgagcttaagttgtcataactgccctgatgtcgtacaggcgctgaactta
atgagcgtgctgaacccgaacatcacgcacacgatgatcgacggcgcagcctttaaagat
gaagctgaaaacaacaacgtcatggctgttccatccgtttatgttaatggcaaattcttt
aaaggcggacgcatgacgcttgaagaaatcatcggcgaaatcgctgatggaccggaccca
gatgagttcaacaacaaagacccttatgacgtccttgtcgtaggcggcggtcctgccgga
tcctctgcagcgatctataccgcacgtaaagggatccgcaccggtgtggtcgcggaacgc
ttcggtggtcaggttcaagacacgctatctattgaaaacttcatcagtgtgaaaaagaca
gaaggaccgaaaatggtcgcaagtcttgaagagcacgtgaaggactataacatcgacgtt
atgaatcttcagcgcgccagccgtcttgagaaaaaagacatgttcgagcttgaactcgac
aacggcggcgtcctgaaaagtaagagcgtcatcctttcaacaggagcgcgctggcgacag
ctcggcgtttctggcgaagcagaattcaagaacaagggcgtcgcctactgccctcactgt
gacggtccattgtttgaaggcaaagacgttgcggtcatcggtggcggaaactccggtatc
gaagcagcgatcgaccttgccggaatcgtcaatcacgtcaccgttcttgaatttggtgct
gaactgaaggctgatgaagtgctgcaagagcgcgtaaacagcctgccaaacgtaacggtt
attaccaacgcacaaacgactgagatcaccggtgatgaaaacgtcaacggccttacctac
atcgaccgtgctacgaacgaagagaagcacatcgaacttgaaggtgtattcgtccaaatc
ggccttgtaccgaacaccgaatggttaggcgacaccgttgaacgtacgcgtacaggtgaa
atcgttgtcgataaacacggcgcaaccaacgttcctggtctgtttgcagcaggagactgc
acagacagcccgtacaaccagatcatcatttcgatgggtgatggagcgaatgctgcgtta
ggttcatttgattatctaatccgaaattaa

DBGET integrated database retrieval system