KEGG   Halobacillus mangrovi: HM131_06555Help
Entry
HM131_06555       CDS       T04799                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K07692  two-component system, NarL family, response regulator DegU
Organism
hmn  Halobacillus mangrovi
Pathway
hmn02020  Two-component system
hmn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:hmn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HM131_06555
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HM131_06555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:hmn02022]
    HM131_06555
Two-component system [BR:hmn02022]
 NarL family
  DegS-DegU (multicellular behavior control)
   HM131_06555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 Sigma70_r4 B12-binding Mob_Pre DUF2089 HTH_40 HTH_23
Motif
Other DBs
NCBI-ProteinID: ARI76517
UniProt: A0A1W5ZTD2
LinkDB All DBs
Position
1368680..1369357
Genome map
AA seq 225 aa AA seqDB search
MTTRIVLIDDHKLFREGVKRILDFESSFEVVAEGDDGSAALNLIEEHAPDVVLMDINMPS
MNGVEATAEITKKYPEMKVIILSIHDDENYVTHALKTGAQGYLLKEMDSDALIDAIKVVS
DGGSYLHPKVTHNLVAEYRRLAENKGSSAYRTIEYRKPLHLLTRRECEVLQLLADGNSNR
GVAESLYISEKTVKNHVSNILQKMNVNDRTQAVVTAIKNGWVEVI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccagaatagtcctgattgatgaccataaattattccgtgaaggcgtaaaaaga
atcttagactttgaatctagttttgaagtagtagctgaaggagacgatggcagcgcggca
ttgaacttgattgaggagcacgcaccagatgtggtgttgatggatatcaatatgccaagc
atgaacggtgtagaagctactgctgaaattacgaaaaaatatcctgaaatgaaagtgatc
atcctatctattcatgatgatgaaaactacgtgactcatgcactgaaaacaggtgctcaa
ggttacttgttgaaggaaatggattctgatgcgttgatcgatgccatcaaagtagtcagt
gatggcgggtcctatcttcatccgaaagtaactcataacttagttgccgaataccgacgt
cttgctgaaaataaaggaagcagcgcttaccgcacgatcgagtatcgtaagccgttgcat
ttgctgactcgccgcgaatgcgaagtgcttcagcttctagctgacggaaacagtaaccgc
ggagtagctgaatccctttatatcagtgaaaagaccgtcaaaaaccacgtgagtaacatt
ttgcagaaaatgaacgttaacgaccggactcaggccgttgttacagcgattaagaatggc
tgggttgaagtcatctaa

DBGET integrated database retrieval system