KEGG   Halobacillus mangrovi: HM131_06845Help
Entry
HM131_06845       CDS       T04799                                 

Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
hmn  Halobacillus mangrovi
Pathway
hmn00340  Histidine metabolism
hmn01100  Metabolic pathways
hmn01110  Biosynthesis of secondary metabolites
hmn01230  Biosynthesis of amino acids
Module
hmn_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:hmn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    HM131_06845
Enzymes [BR:hmn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     HM131_06845
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     HM131_06845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG Nup96 PAD_porph
Motif
Other DBs
NCBI-ProteinID: ARI76568
UniProt: A0A1W5ZTE9
LinkDB All DBs
Position
1429891..1430514
Genome map
AA seq 207 aa AA seqDB search
MNIDEIKFDEKGLVPAIVQDARSKAVLTLAYMNEESLRKTLEMKETVFFSRSRQELWHKG
ETSGNTQKVTDLRYDCDQDAILVEVIPAGPACHKGDYSCFSESLMEENTEPKENRYQIID
QLQEVLAERKAELPEGSYTAQLFQEGVDRIAKKIGEEAGEVIIAAKNDDPEELALESADL
LFHLLMLLTDRNVPLDNVLSVLERRHS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagatgagattaagtttgatgaaaaagggctcgttccagcgatcgtgcaggac
gcacgctcgaaggcagtgcttacactcgcttacatgaatgaggagtctttgagaaaaacc
cttgaaatgaaagaaacggtcttcttcagccgttcccgccaggaattgtggcataagggc
gagacctccggaaacacccaaaaggttactgatctccgatatgattgtgaccaggatgct
atccttgtagaagttattcctgcaggtcctgcctgtcataagggagattacagttgtttt
tctgaatccctcatggaagaaaatacggaaccgaaagagaaccgttatcaaattatcgat
caacttcaggaagtacttgctgagcgaaaggctgaacttccggagggttcctacactgct
caattgtttcaggaaggtgttgatcggatagcgaaaaaaatcggagaggaagcaggcgaa
gttattattgcagcaaaaaatgatgacccagaggaattggctttagagtcggcggactta
ctcttccacttattaatgctcttaacggaccgaaatgttccgcttgataacgtattatct
gttctcgaacgacgacattcataa

DBGET integrated database retrieval system