KEGG   Halobacillus mangrovi: HM131_08175Help
Entry
HM131_08175       CDS       T04799                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hmn  Halobacillus mangrovi
Pathway
hmn00010  Glycolysis / Gluconeogenesis
hmn00030  Pentose phosphate pathway
hmn00051  Fructose and mannose metabolism
hmn00052  Galactose metabolism
hmn00680  Methane metabolism
hmn01100  Metabolic pathways
hmn01110  Biosynthesis of secondary metabolites
hmn01120  Microbial metabolism in diverse environments
hmn01130  Biosynthesis of antibiotics
hmn01200  Carbon metabolism
hmn01230  Biosynthesis of amino acids
hmn03018  RNA degradation
Module
hmn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hmn_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:hmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HM131_08175
   00030 Pentose phosphate pathway
    HM131_08175
   00051 Fructose and mannose metabolism
    HM131_08175
   00052 Galactose metabolism
    HM131_08175
  09102 Energy metabolism
   00680 Methane metabolism
    HM131_08175
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    HM131_08175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hmn01009]
    HM131_08175
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:hmn03019]
    HM131_08175
Enzymes [BR:hmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HM131_08175
Protein phosphatases and associated proteins [BR:hmn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HM131_08175
Messenger RNA biogenesis [BR:hmn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HM131_08175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 PGP_phosphatase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ARI76818
UniProt: A0A1W5ZU56
LinkDB All DBs
Position
1690476..1691435
Genome map
AA seq 319 aa AA seqDB search
MKKIGVLTSGGDAPGMNAAIRAVVRKAIYHGLEVYGVKYGFQGLIDGNIEKMELGSVGDI
IQRGGTKLYSARCEEFKTEEGQLKGIEQLKKHGIEGLIVIGGDGSFMGAKKLTEKGYPCI
GVPGTIDNDIPGTDFTIGFDTALNTIIDAIDKIRDTATSHERTYVIEVMGRDAGDLALWA
GLADGAESVLIPEAEDEFEDVIERLKRGHDRGKKHSIIIVAEGVGSGVDFGRKIKEAVNL
ETRVTVLGHTQRGGSPSASDRVLASRLGAHSVDLLLDGKAGRMVGIQQNKLVDHDIVEIL
STKHEVDLDMYRLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaataggcgtacttacaagtggcggtgacgcacctggtatgaatgctgccatt
cgtgcagtcgtccgtaaagcgatctatcatggtcttgaagtctacggagtcaaatatggc
tttcaaggtttaatcgatggaaatatagaaaagatggaactaggttctgttggtgatatc
attcagcgtggagggacaaaactttactctgctcgctgtgaagaattcaagacagaagaa
ggccaattaaaaggaattgagcagttaaaaaaacatggcattgaaggattaatcgttatc
ggtggcgatggttccttcatgggtgccaaaaaattgactgaaaaaggatatccgtgcatt
ggggtgccaggtaccatagataacgatattcctggaactgatttcacaatcggttttgac
acagcattaaacacgattattgatgcaattgataaaattcgtgacacagctacctcacat
gagcgtacgtacgtcatcgaggtaatggggcgcgatgctggagatttagcgttatgggca
ggtcttgccgatggtgcagaatctgtgttaatcccagaagccgaagatgaatttgaagat
gtgattgagcgattgaagcgtggtcatgatcggggtaagaaacacagcattatcattgtt
gctgaaggtgtcggaagcggtgttgattttggtagaaaaatcaaagaggctgtgaatctt
gaaacacgcgtaaccgtactcggtcacactcagcgtggcggctcaccttcagcttcagac
cgagttcttgccagtcgcttaggtgctcattcagttgaccttctgcttgatggtaaggct
ggccgcatggtaggtattcagcaaaataaattagtggatcatgatattgtagaaattctt
agcacgaagcatgaagtagaccttgacatgtatcgtctttcaaaagaattgtccatataa

DBGET integrated database retrieval system