KEGG   Halobacillus mangrovi: HM131_12570Help
Entry
HM131_12570       CDS       T04799                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hmn  Halobacillus mangrovi
Pathway
hmn00010  Glycolysis / Gluconeogenesis
hmn00053  Ascorbate and aldarate metabolism
hmn00071  Fatty acid degradation
hmn00280  Valine, leucine and isoleucine degradation
hmn00310  Lysine degradation
hmn00330  Arginine and proline metabolism
hmn00340  Histidine metabolism
hmn00380  Tryptophan metabolism
hmn00410  beta-Alanine metabolism
hmn00561  Glycerolipid metabolism
hmn00620  Pyruvate metabolism
hmn00625  Chloroalkane and chloroalkene degradation
hmn01100  Metabolic pathways
hmn01110  Biosynthesis of secondary metabolites
hmn01120  Microbial metabolism in diverse environments
hmn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HM131_12570
   00053 Ascorbate and aldarate metabolism
    HM131_12570
   00620 Pyruvate metabolism
    HM131_12570
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HM131_12570
   00561 Glycerolipid metabolism
    HM131_12570
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HM131_12570
   00310 Lysine degradation
    HM131_12570
   00330 Arginine and proline metabolism
    HM131_12570
   00340 Histidine metabolism
    HM131_12570
   00380 Tryptophan metabolism
    HM131_12570
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HM131_12570
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HM131_12570
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HM131_12570
Enzymes [BR:hmn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     HM131_12570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh MtaB
Motif
Other DBs
NCBI-ProteinID: ARI77628
UniProt: A0A1W5ZWH9
LinkDB All DBs
Position
complement(2547742..2549166)
Genome map
AA seq 474 aa AA seqDB search
MRNYLKHYINGEWVESTGSDVEEVINPATEEVIGKISIGTKEDLDKAVKAAREAFPSFST
MPKDERVKMLERIAEEYEKRKEDIIETITDELGSPLAVSEKVHYMMGYNHFSQAAESLKE
FSFIEDMGGHTRVKESVGVSGLITPWNFPTNQTSTKIASAFAAGSPVILKPAEVTPFAAI
ILAEIFEAAGVPKGVFNLVNGKGDVIGDGISSHPDIDFVSFTGSGRVGKKIMQNASETIK
NVALELGGKSPLVVLEDADIEQAARTAVNHIATNTGQVCSAATRILVPNSMKEAFEEAVL
KVLPEFSVGNPREDNQVGPLISKKQWDTVQSYIEKGVEEGATLLSGGTGKPEGLDKGYYT
KLTVFSDVTNDMTIAEEEIFGPVMSILTYEDLDDAIKISNDTEYGLAGYVVGEDKKALRK
VATSIRAGRIKVNDAEADFAAPFGGFKQSGIGREWGDHGIEEYLETKTILGYPS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaattatcttaaacattacattaatggtgagtgggttgaatctacaggttcggat
gtcgaagaggtgatcaacccggctacagaagaagtaataggaaaaatcagcataggaaca
aaggaagatttagataaagcagtgaaagcagctagagaggcgtttccttctttttcgact
atgcctaaagatgaacgagtgaaaatgcttgaacgaatcgcagaagagtatgagaaacga
aaagaagacattatagaaactattacggatgaactaggttctcctttagcagtttctgaa
aaagttcattatatgatgggttacaaccatttttctcaagctgccgaatctttgaaagag
ttctcttttatcgaagatatgggcggtcatacacgtgttaaagaatcggtcggcgtcagt
ggcttaattacaccttggaatttcccaacaaatcaaacctctactaaaattgcgagtgct
tttgcggctggcagcccagtcatattgaaaccagcagaagttaccccgtttgctgcaatt
attttagcggaaatatttgaagcagctggagttccgaaaggggtattcaatcttgtaaac
ggtaaaggagacgttattggggatggcatcagctctcatccagatatcgacttcgtgtca
tttaccggctcaggcagagtaggtaagaaaatcatgcaaaatgcatctgaaaccattaag
aacgttgctctcgagcttggcggcaagtcaccacttgtcgtattggaagatgcggacatc
gaacaagcagcaagaacagctgttaatcatatcgctacaaacacaggtcaagtctgttca
gccgcaactcggatattggttcctaattcaatgaaagaggctttcgaagaagctgtcttg
aaagtgctcccagaattttctgtgggaaatcctcgtgaagataatcaagtgggtccgctc
atatctaagaaacaatgggatacagtacaatcttatattgaaaaaggagtagaggaaggt
gcgactcttctctctggtggcactggaaaaccagaagggctagataaaggctattatact
aagttgacagtgttttcagatgtgacaaacgacatgaccatagcagaagaagaaatattc
ggtccggtaatgtctattcttacgtacgaagaccttgatgatgccatcaagataagtaat
gatacagagtacggattagccggatatgtggtaggagaagacaaaaaagccctaagaaaa
gtagcgacaagcatccgggcaggtcgaattaaggtaaatgatgcagaagcagactttgca
gctccattcggcggttttaagcaatcaggaatcggaagagagtggggagatcatggtatt
gaagaatatctagaaacgaaaactattcttggatatccatcctaa

DBGET integrated database retrieval system