KEGG   Halobacillus mangrovi: HM131_17130Help
Entry
HM131_17130       CDS       T04799                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hmn  Halobacillus mangrovi
Pathway
hmn00620  Pyruvate metabolism
hmn00680  Methane metabolism
hmn01100  Metabolic pathways
hmn01120  Microbial metabolism in diverse environments
hmn01200  Carbon metabolism
Module
hmn_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HM131_17130
  09102 Energy metabolism
   00680 Methane metabolism
    HM131_17130
Enzymes [BR:hmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HM131_17130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF2067 Josephin RbsD_FucU
Motif
Other DBs
NCBI-ProteinID: ARI78453
UniProt: A0A1W5ZYU9
LinkDB All DBs
Position
3408989..3411748
Genome map
AA seq 919 aa AA seqDB search
MTTQSRTNDHTTPLRQDISSLGKMLGNILVHHGGDELLNKVETIRTLTKDLRNNPTEKTY
DQLKEEIHSLEPPMRAQVIRAFSIYFHLVNIAEQNHRIRRRREYQLREDHGVQPFSLDSA
VQNLKENNFSKEVIQDVLNHLSLELIITAHPTEATKRTVLEIQKRIATILKQLDHPQLTK
HEKESLLDSLQNEVTVLWQTDELRERKPTVMDEVRNGLYYFDETLFEVLPDIHQELETRL
EEAYPDEDWSVPNFLRFGSWIGGDRDGNPNVTPDVTWKTLQKQRELVLKKYEGVIIELMK
RFSHSTSQIEVSEKLIRSVKEQESLLPNDKKWRADKEIYRRKFAIILERLRQVGKSETGY
QYADELLEDLKQIQESAVTHQPGKGELKKLRKLVRQVELFGFHLATLDIRNHSGEHESAI
AELLKKVGIVEDYSSLEESEKLKVLQDVLKDPRPISLLNEDYSESTQEMLKVFQMIREAH
IEFGRRSIEVYLISMTESASDLLEVLVLAKEAGIYRLHTDGTVESNINVAPLLETVDDLV
AGPEILKTLFEMDVYNKHLAEHDNHQEIMLGYSDGSKDGGTLTANWRLYKAQLEIHDMAR
EYNVGLKFFHGRGGSLGRGGGPLNRSLLSQPVETLGDSVKITEQGEVLSSRYMLTDIAYR
SLEQAASTLLEGAANVSQESEQGHHREEIWEKAMEEISEVSLKKYQSLVFGDKDFLTYFN
EATPLQEISELNIGSRPMKRKDSSKFENLRAIPWVFAWTQNRQLIPAWYASGAGLSHYAS
QSDEHLAQLKQMYESWPFFRTTINNLQMALTKADIQTAKEYKELVNDQEVGERIFNTIVE
EYDRTKEVLLQISGDQELLDHQPTIKDSVRLRNPYVDPLNFLQVELIKELRQNEDINDDI
LTEVLLTISGIAAGLRNTG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
gtgactactcaaagtagaacaaacgatcatactactccattacgccaggacatcagttcc
ctcggtaagatgttaggaaacattctcgttcatcacggcggtgatgaactgttgaataaa
gtagagaccatccgaacgcttactaaagatctgaggaacaaccctactgaaaaaacatat
gaccaactaaaagaagaaatccatagcctcgaaccacctatgcgcgctcaagtgattcgc
gcgttttctatctattttcacctcgtcaatatcgctgaacaaaaccaccgtattcgcaga
cgccgcgaatatcaactcagagaagaccacggtgtacagcctttctcactcgatagtgct
gtacaaaacctaaaagaaaataacttctctaaagaagtcattcaagatgtactaaaccat
ctatcgttagagctgatcattaccgctcacccgacagaagcaacaaagcgtaccgtactt
gaaatccaaaaacgaattgctacgattctgaaacagctggatcatcctcaattgacgaag
catgaaaaagaaagcctgctagacagcctgcaaaatgaggtgaccgttctttggcagacc
gatgagcttcgcgagcgaaaaccaacggtcatggatgaagtacgtaacgggctttattat
ttcgacgaaacgctatttgaagttctgccagatattcatcaggagctggaaacgcgcttg
gaagaagcctatcctgatgaagattggtcggtaccgaactttttacgttttggctcctgg
atcggcggtgaccgtgacggaaatccaaatgttaccccagatgtaacgtggaagacactt
caaaagcagcgtgagcttgttttgaaaaaatatgaaggggtcatcattgaactgatgaaa
cgattcagccactctacatcacagatagaggtatctgaaaagctgattcgatctgtcaag
gagcaagaaagtctgcttcctaatgacaaaaaatggcgtgcggataaagaaatctatcgt
cgtaaatttgcaatcatcttagaacggctgcgccaggtcggaaaatctgaaacaggttac
cagtatgctgatgagttgctggaagatttaaaacagattcaggaaagcgcagttacccac
cagccaggaaaaggcgagttgaaaaaattacgtaaactggttcgacaagtggaactgttc
gggttccatttagctacacttgatattcgaaaccatagtggtgaacatgaatcagccatt
gccgaacttctgaaaaaagtcggcatcgttgaagactatagttcacttgaagaaagtgaa
aaattgaaggtgcttcaagatgttctgaaagacccgcgtcctatttctctgttgaatgag
gattattctgagtcaactcaggaaatgctgaaagtctttcaaatgatccgcgaagcacat
attgaattcggaagacgctcaatcgaagtgtatttgatcagtatgaccgaatcggcaagc
gacttgcttgaagtccttgtccttgctaaagaggcaggtatttatcgtcttcatacggac
gggacagtggaaagtaacatcaatgtagctccactccttgaaacggtcgacgacctcgtt
gcaggacctgaaatattgaaaacactctttgaaatggatgtttacaacaaacacttggct
gagcatgacaatcatcaggagatcatgctgggatattcagatggaagtaaagatggcgga
acattgacggcaaactggcgtctttacaaagcccagcttgagattcatgacatggcccgc
gaatacaatgtgggacttaagttcttccacggccgtggtggctcccttggacgtggcggc
ggcccgctcaatcgcagtcttctttctcaaccagtagaaactctaggggacagtgtgaaa
attacagaacaaggggaagtattatcttccaggtacatgcttactgacattgcgtaccgc
agtcttgaacaagctgcttccacactcctggaaggggctgcaaatgtttcccaagaatct
gagcagggccaccaccgtgaagaaatatgggaaaaagcaatggaagaaatctcagaagtt
tctcttaagaaatatcagtctcttgtcttcggagataaagatttcttaacctactttaat
gaagcgacgccactgcaggaaatcagtgaattgaacattggttcccgcccaatgaaacgg
aaagacagttcgaagtttgaaaacctgcgcgcgatcccgtgggtttttgcgtggacacaa
aaccgccagctgattccagcctggtatgcttcaggagcaggcctatcacactatgcttct
caaagtgatgaacatctggctcagctgaaacaaatgtatgaaagctggcctttcttccgc
acaactatcaataacttgcagatggccttgacaaaagctgatattcaaactgcaaaagaa
tacaaggaacttgtcaatgatcaggaagttggcgaacgtatcttcaatacaattgttgag
gaatatgatcgcacgaaggaagtgctattgcagatttcaggggatcaggagctattggat
caccagccgaccatcaaagattcagtacgactgcgtaatccatatgttgatccgctgaac
ttcttacaagtggagttaattaaggagctccgccaaaacgaagatatcaacgatgacatt
ttaactgaggtgctgctgaccatcagtggaattgcagctggtcttcgtaatacaggttga

DBGET integrated database retrieval system