KEGG   Halobacillus mangrovi: HM131_17445Help
Entry
HM131_17445       CDS       T04799                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
hmn  Halobacillus mangrovi
Brite
Enzymes [BR:hmn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HM131_17445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu FlgD_ig DUF3558
Motif
Other DBs
NCBI-ProteinID: ARI78512
UniProt: A0A1W5ZZ06
LinkDB All DBs
Position
3471153..3471758
Genome map
AA seq 201 aa AA seqDB search
MKRWSLRVFPLFLVLILVSCGSTEEGTGGSENEEETTTGEENQEQTDSEKPPETITVQLK
DSDGKEVGTAELEQEDQGVDINLVDSSLPEGMHGFHIHEKGSCEAPDFKSSGCHFNPTDV
SHGTESEDGPHAGDLPNIEAGEDGSVQKEVTADQVTLKKGEKNSLLKEGGTALVIHSKAD
DNKSQPSGDAGERIACGVIEK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtggagcctgagggttttcccattattcctagtgcttattctggtttcatgt
ggatcgacggaggaaggtactggaggttcagaaaatgaagaagaaacaacgacaggcgaa
gaaaatcaggaacagacagattcagaaaaacctcctgagaccatcactgtacagttaaaa
gatagcgatggtaaagaagtaggaacagctgaactggaacaggaagaccagggagtagat
atcaatttagtcgactcttctttacccgaaggaatgcatggatttcatattcatgaaaaa
ggttcgtgtgaagcccctgacttcaaatcttctggctgccactttaatcctactgatgtt
agtcacgggacagagtccgaagatggaccgcacgccggcgatctccctaatattgaggca
ggtgaagatggttctgttcaaaaagaagtaactgcggatcaggttactctcaaaaaagga
gagaaaaactccttattgaaagaaggcggtacggctcttgtgatccactcaaaagcagat
gataataagtctcagccctcaggggatgcaggcgaacgaatcgcatgtggagttatagaa
aaatag

DBGET integrated database retrieval system