KEGG   Halobacillus mangrovi: HM131_19320Help
Entry
HM131_19320       CDS       T04799                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hmn  Halobacillus mangrovi
Pathway
hmn00473  D-Alanine metabolism
hmn01100  Metabolic pathways
hmn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hmn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HM131_19320
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    HM131_19320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hmn01011]
    HM131_19320
Enzymes [BR:hmn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HM131_19320
Peptidoglycan biosynthesis and degradation proteins [BR:hmn01011]
 Precursor biosynthesis
  Racemase
   HM131_19320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ARI78838
UniProt: A0A1W5ZZU1
LinkDB All DBs
Position
complement(3880927..3882081)
Genome map
AA seq 384 aa AA seqDB search
METFYRDSWVEVNLSAIEYNIKQLRQRLNSETKIYAVVKANAYGHGDERVAKKALESGAD
GLAVALLDEAVKLRKAGFTAPVLVMGWIRPEDAPLAAEREIAVTVFQEEWLRMVDSSQLS
KPLKLHMKWDTGMGRIGIRTTEEMDRILPLIKEQPNFKLEAVFTHFATADEVSLNYFEEQ
EKRFYKLLSHFERVWSGNVEFHIGNSAASMRFPDRMKQYVRFGISMYGLYPSNAVKEERP
IDLKPAFSLQSRLVHVKRLEAQESISYGATYQAENEEWIGTIPLGYADGWIRKLQGMEVL
VNGKRHPIVGRICMDQFMIRLDQEYPIGTKVTLIGKQGDEEVTTDEVADYLETINYEVPC
MISNRVPRVFIEDGQIVEVNNPVK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttctatcgggattcttgggttgaagtaaatttatcagcaattgaatacaat
ataaaacaactccggcagcgccttaattcggagacgaagatctatgcggttgtcaaagcg
aatgcgtatggtcatggagatgagcgggtagcaaagaaagcattggaatcaggtgcagat
ggactagcagtagctttgttagatgaggcagtgaaactgcgtaaggctggatttacagcg
cctgtacttgtcatgggctggattcgtccggaggatgcaccgttagcagctgaaagggaa
attgccgttaccgtcttccaggaagaatggcttaggatggtcgattcttctcaattgtcc
aagccgttgaagcttcatatgaaatgggatacaggtatgggccgaataggcatccgtacg
acagaagaaatggatcgtattctaccactaattaaggagcagcctaactttaagctggaa
gctgtgtttacccactttgctacggcggatgaagtttcgttgaattattttgaagaacaa
gagaaacgtttttataaattattgagtcatttcgaaagggtttggtcaggaaatgtcgaa
tttcatatagggaacagtgctgccagtatgaggttccctgatcggatgaaacagtatgtc
cggttcggtatcagtatgtatggcctttatccttcaaatgcggtaaaagaggagcggccg
atcgatttaaaaccagctttctctttgcagagtcgtttagtacatgtaaaaagactggaa
gcacaggagtcgatcagttatggtgcgacttatcaagcggaaaatgaggagtggattggt
accatacctcttggatatgccgatggctggatccgtaaattgcaggggatggaagtcctt
gtgaatggaaaacgtcatcctattgtcggcagaatttgtatggatcaattcatgattagg
cttgatcaggaatatcctatagggacaaaggttaccttaattggtaaacaaggagatgaa
gaggttacgacggatgaagtggcagactacttggaaaccatcaattacgaggttccttgc
atgattagtaaccgggtccctagagtgtttattgaagatgggcaaattgtagaagttaat
aacccagtgaaatag

DBGET integrated database retrieval system