KEGG   Heliobacterium modesticaldum: HM1_0076Help
Entry
HM1_0076          CDS       T00653                                 

Gene name
pykA
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
hmo  Heliobacterium modesticaldum
Pathway
hmo00010  Glycolysis / Gluconeogenesis
hmo00230  Purine metabolism
hmo00620  Pyruvate metabolism
hmo01100  Metabolic pathways
hmo01110  Biosynthesis of secondary metabolites
hmo01120  Microbial metabolism in diverse environments
hmo01130  Biosynthesis of antibiotics
hmo01200  Carbon metabolism
hmo01230  Biosynthesis of amino acids
Module
hmo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hmo_M00002  Glycolysis, core module involving three-carbon compounds
hmo_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
hmo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HM1_0076 (pykA)
   00620 Pyruvate metabolism
    HM1_0076 (pykA)
  Nucleotide metabolism
   00230 Purine metabolism
    HM1_0076 (pykA)
Enzymes [BR:hmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     HM1_0076 (pykA)
Membrane trafficking [BR:hmo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HM1_0076 (pykA)
Exosome [BR:hmo04147]
 Exosomal proteins
  Proteins found in most exosomes
   HM1_0076 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C PEP-utilizers HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABZ82701
UniProt: B0TI28
LinkDB All DBs
Position
complement(65427..67217)
Genome map
AA seq 596 aa AA seqDB search
MHAYIQKASLSGTPRTKIVCTVGPASSDPTILMEMIRAGMRVARLNFSHGTYEEHAARIA
AVRQAADALGQPIAILLDTKGPEIRLGQVSGGKITLDEGAEVTLFPDDGTLGTKERLPIS
YAGLVEDVRPGVRVLIDDGNIEMEVTAVEAGEIRCRIKNGGDVSSRKGVSVPGVALRMPA
ISEKEVKDLEFGIAQDMDFVAISFVRDASDVLGIRKILEDRGASMQLIAKIENHQGVDNI
DEILAVSDGIMVARGDLGVAIPTEDVPLVQKMIIEKCNIAGKPVITATQMLDSMIRNPRP
TRAEATDVANAILDGTDAIMLSGETAAGKYPVEAVTMMARIAIRTEQALRHDEELDRRRK
AGLGSVTDSISHATCSIAADLKAKAIITLTKAGSTARMVSRYRPDCPIIAATPETKVMRQ
MAVVWGAEPMKVRETAGTDEMLGDAIDCALKEGRIESGDLVVVTAGVPVGVSGTTNLLKV
HVAGRVLAHGMGISRKKAVGKVRLCRSAADAARLERGEILVAYGTDRDYVPALERCAGII
TVEGGLTSHAAIVGLQFGIPVIVGVDNAFEVLPDGAVVTIDATERGMIYEGTARVL
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcctatatccaaaaggcttctctgtccggaacgccccgcacgaagatcgtctgc
accgtcggaccggctagttctgaccctaccatcctgatggagatgattcgggccggcatg
cgggtggcccggctgaacttttcccacggcacctacgaggagcatgccgcccgcatcgct
gccgttcgccaggcggccgatgccttagggcagcccatcgccatcctcctcgacacgaaa
ggcccggagatccgcctcggccaagtgtccggcggcaaaatcacccttgacgaaggcgcg
gaagtgaccctcttccctgacgatgggaccttggggacgaaggagcgcctgcctatcagc
tacgccgggctcgttgaagatgtccggcccggcgtacgggtgcttatcgacgacgggaac
atcgagatggaagtgacggctgtggaggccggtgagatccgctgccgcatcaaaaacggc
ggcgatgtgagcagccgcaagggtgtcagcgtccccggcgtggccttgcgcatgccggcc
atcagcgaaaaggaagtgaaggatctcgagttcggcatcgcccaggacatggattttgtc
gccatctcctttgtccgcgacgcctctgatgtgctcggcatccgcaagatcctggaagac
cgcggcgcctccatgcagctgatcgccaagatcgagaaccaccagggcgttgacaacatc
gacgagatcctggccgtctctgacgggatcatggtcgcccggggcgatctcggggtggcc
atcccgacggaagacgtccctctggtgcagaagatgatcatcgaaaagtgcaacatcgcc
ggcaagccggtgatcacggcgacccagatgctcgattcaatgatccgcaaccctcggccc
acccgggccgaagcgacggacgtggccaacgccatcttggatggaaccgatgccatcatg
ctctccggcgagacggcagccggtaagtaccctgtcgaggccgtcacgatgatggcccgc
atcgccatacgtaccgaacaagccctccgccacgatgaggaactggatcgccgccgcaaa
gccggccttggctcggtcaccgattcgatcagccatgctacctgcagcatcgcggccgac
ttgaaggcaaaggcgatcatcaccctcacgaaagccggctcgacggctcgcatggtctcc
cgctaccgccctgattgccctatcatcgccgcgacgccggagacaaaagtgatgcgtcag
atggccgtcgtctggggcgccgagccgatgaaggtgcgggagacggcggggacggacgag
atgctcggcgacgctatcgactgcgctctgaaggaaggccgtatcgagtcaggcgacctc
gtcgtcgtcacggccggcgtccctgtcggcgtatccggaacgaccaacctgctcaaggtt
catgtggccggtcgggtgctggcccacggcatgggcatcagccgcaagaaagcagtcggc
aaggtgcgcctctgccgatccgccgccgacgccgcgcggctggagcggggcgagatcctc
gtcgcctacggcactgatcgagattacgtgccggcccttgaacgctgcgccggcatcatc
accgtggaaggcggcctcacctcccacgcggctatcgtagggctgcagttcggtatcccc
gtcatcgtcggcgtcgacaacgccttcgaggtccttcccgacggcgccgtggtcaccatc
gacgccaccgagcgagggatgatctacgagggaacagcgcgggttttgtaa

DBGET integrated database retrieval system