KEGG   Heliobacterium modesticaldum: HM1_1597Help
Entry
HM1_1597          CDS       T00653                                 

Gene name
glpA
Definition
(GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit a
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hmo  Heliobacterium modesticaldum
Pathway
hmo00564  Glycerophospholipid metabolism
hmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hmo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HM1_1597 (glpA)
Enzymes [BR:hmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HM1_1597 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD Pyr_redox_2 FAD_binding_3 FAD_binding_2 Csc2
Motif
Other DBs
NCBI-ProteinID: ABZ84167
UniProt: B0TDC6
LinkDB All DBs
Position
1613781..1615385
Genome map
AA seq 534 aa AA seqDB search
MVTERVQVVVIGGGATGTGILRDLAMRGISALLVEQGDLAHGTSSRFHGLLHSGGRYAVK
DKEAAKECIEENLLLRRLAPDCIEPTGGLFAQLPSDDPAYADQWVKACAEAGIETEELDV
KTLIKKYPVLSPKITRAFTVPDAAVDGFRLLWSNVHSARRYGAQMANYSKLTAIHCSNGR
VTGVEITNTLTGEKRPIECEMVINAAGAWAGEVTALAGLDVSIIKDKGTLLAFNHRLTNQ
VVNRLRPPGDADIFVPHGTITLLGTTSVAVDDPNSFKTTDKEVREMLAVGREMMPRIDDY
RIIRAFAGVRPLYQADKGAGGRAVTRNFALIDHAQRDGLTGLISIVGGKFTTFRLMAEKT
VDLAAKKLGNSTPCRTKEEPLSAAQPAELMERGKKVFGVPGAKKAAERLGQDFAKVVAEA
EKDRTKRRMFCECEMVSAAEIDHVASDGDSKTLSDIRRKTRMGMGTCQGIFCSYRTLGAM
SDHKQFTGTHREFLAEFLQNRWRGVRAVLWGQQLREAQLSSEIFCTLFGMERMK
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccgaacgcgttcaggtggtggtgatcggaggcggcgccactgggacaggcatc
ctgcgcgacctggccatgcggggcatttcggccctcctggttgagcaaggcgacttggcc
cacggcaccagttcccgcttccacgggctgctgcacagcggcggtcgctatgccgtcaag
gacaaagaggcggcgaaagagtgcatcgaagagaatctcctgctgcgtcgcctggcgccc
gactgcatcgagccgacgggtggcctcttcgcccaactgccgagcgacgacccggcctat
gccgaccagtgggtgaaggcttgcgctgaggcgggcatcgaaacggaagaactcgacgtg
aagactttgatcaaaaaataccccgtcctctcaccgaagatcacccgcgcctttacggtg
cccgatgcggccgtcgatggcttccgtctgctctggagcaacgtccattcggctcgacgt
tacggcgcccaaatggccaactacagcaaactgacggcgatccattgttcaaatggccgc
gtcaccggtgtggagatcaccaacaccctaaccggcgaaaagcgcccgatcgaatgcgag
atggtgatcaacgccgccggcgcctgggccggcgaagtgacggcactggccggcctcgac
gtgagcatcatcaaggataagggcaccctgctcgcctttaaccatcggttgaccaaccag
gtcgtcaaccgcctgcgcccccccggcgacgccgacatcttcgttccccacggcaccatt
acgctgctgggcacgacctcagtggcggtagacgatcccaacagctttaagacgactgat
aaagaggtccgggagatgcttgccgtcggccgggagatgatgccccgcatcgacgactac
cgaatcatccgggcctttgcgggcgtgcggcccctttaccaagcggacaagggcgccgga
ggccgggcggtgacgcgcaacttcgcgctcatcgaccacgcgcaacgtgatggcctcacc
ggcctgatcagcatcgtcggcggcaagttcaccaccttccggttgatggccgaaaagacc
gttgacctggctgccaaaaaactcggcaacagcaccccctgtcggacgaaggaagaaccc
ctcagcgcggcccagccggcggaactgatggagcgggggaaaaaggtcttcggcgtcccc
ggcgccaagaaggcggcagagcggctcggacaagatttcgccaaggtcgtcgctgaggcg
gagaaagaccgcaccaagcgccgcatgttctgcgagtgcgagatggtcagcgccgccgag
atcgaccatgtggccagtgacggcgacagcaagaccttgagcgatatccgccgcaaaacc
cgcatgggcatgggcacctgtcagggcatcttctgcagctaccgcaccctgggggcgatg
agcgaccacaagcagttcaccggcacccaccgcgagtttttggctgagtttttgcaaaac
cgctggcgcggcgtccgggcggtcctctggggccagcaactgcgggaagcccaactgtcc
tcggagatcttctgcacactcttcggcatggagagaatgaaatga

DBGET integrated database retrieval system