KEGG   Hippea maritima: Hipma_0516Help
Entry
Hipma_0516        CDS       T01456                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
hmr  Hippea maritima
Pathway
hmr00970  Aminoacyl-tRNA biosynthesis
hmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Hipma_0516
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hmr03029]
    Hipma_0516
Enzymes [BR:hmr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Hipma_0516
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Hipma_0516
Mitochondrial biogenesis [BR:hmr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Hipma_0516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: AEA33487
UniProt: F2LUG1
LinkDB All DBs
Position
518706..520133
Genome map
AA seq 475 aa AA seqDB search
MEFEAVIGLEVHIQLLTNTKIFCSCSTDFGAPPNTHICPVCMGMPGVLPVLNKKVLDYAI
KLGLALNCKINKFSRFARKNYFYPDLPKGYQISQYELPILEGGHVEIFVNGEYKKIGLER
IHMEEDAGKTIHRPDGSYVDFNRAGVPLLEIVSLPVMHSPQEAGEYLRSLRRIVRYLGIC
DGNMEEGSLRCDANVSIRPKGQTKLGTKTELKNMNSFRHVEKALEYEIQRQIEVVEDGGK
IIQQTRLWDEKTGMTKPMRSKEEAYEYRYFPDPDLVPIFIDDEWIERIKDEVPELPRQKL
ERFVEEYGLKEEDARVLVEEKSLADYFEEAAKGYKKPQSIANWILSELLGYLNKENKNIE
DTLIKPNHIRELVELIDSGLISGKIAKTVFGKMYETAKSPKQIVEEEGLVQITDRSQIEG
IVDEVIKANPKAVEQYKSGKKNTIGFFVGQVMKKTKGKANPKLVNEILASKLEEL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgaggccgtaataggtttagaggttcacatacagcttctgaccaatacaaaa
atattctgtagttgctctactgattttggggcacctccgaacacacacatatgccctgtg
tgtatgggtatgccaggggtgcttccggtacttaacaagaaggttttggattatgctata
aaattaggcttggccctaaattgcaaaataaataaattttcacggtttgcaaggaagaat
tatttttatccagatctacccaaggggtatcagatatcgcagtatgaattgcccattttg
gaaggtggtcatgttgagatatttgttaacggtgaatataaaaaaatagggcttgagaga
atacatatggaagaggacgccggaaaaaccatacacaggccagatggcagttatgttgat
tttaacagggctggtgttccattacttgagatagtttctctgcctgtaatgcattcccca
caggaggctggtgagtacttgcgctcattgcgcaggattgttagatatttgggtatatgc
gatggcaatatggaagagggctctttgaggtgtgatgcgaatgtttctataagacccaaa
ggccagacaaagcttggaacaaaaacagaacttaagaatatgaattcattcaggcatgtt
gagaaggcattggagtatgaaattcaacgccagatagaggttgtggaagatggaggaaaa
ataatacagcaaacaaggttatgggatgaaaagaccggaatgactaaaccaatgagaagc
aaagaagaggcttatgaatacagatacttcccagatccagatcttgtgcctatttttata
gatgatgagtggatagaaaggataaaggacgaggtgcctgagcttccaaggcaaaaatta
gaacgttttgttgaagagtatggtttaaaagaagaggatgcaagggttttggttgaagaa
aaatcattagctgactactttgaagaagctgcaaagggctataaaaagccacagtcaata
gcaaactggatattgtcagagcttttgggctatctgaataaggaaaacaaaaacatagag
gataccttaattaagccaaatcatataagagagcttgttgaacttatagatagtggcctt
ataagcggtaaaatcgcaaaaaccgtttttggcaagatgtatgaaactgctaagtcaccc
aagcagattgttgaagaagagggtcttgttcaaataactgatagatcacaaattgaaggt
attgtagatgaggtaattaaggccaatccaaaggccgttgagcagtataaatctggcaaa
aagaatacaataggtttctttgtgggtcaggttatgaaaaagacaaagggtaaggcaaat
ccaaagcttgttaatgagatacttgcttctaaattggaggagttatga

DBGET integrated database retrieval system