KEGG   Helicobacter mustelae: HMU04100Help
Entry
HMU04100          CDS       T01191                                 

Gene name
trpD
Definition
(GenBank) anthranilate synthase component II; anthranilate phosphoribosyltransferase
  KO
K13497  anthranilate synthase/phosphoribosyltransferase [EC:4.1.3.27 2.4.2.18]
Organism
hms  Helicobacter mustelae
Pathway
hms00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hms01100  Metabolic pathways
hms01110  Biosynthesis of secondary metabolites
hms01130  Biosynthesis of antibiotics
hms01230  Biosynthesis of amino acids
Module
hms_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hms00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMU04100 (trpD)
Enzymes [BR:hms01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     HMU04100 (trpD)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     HMU04100 (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 GATase Glycos_trans_3N Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: CBG39672
UniProt: D3UGQ1
LinkDB All DBs
Position
complement(469640..471238)
Genome map
AA seq 532 aa AA seqDB search
MLLLIDNYDSFTYNIYQAFCMLHQKVLVVRSDKITCEQIQELNPSHIIIGPGPKTPKEAG
ISMEVIQKFYKKIPILGICLGHQAIMASFGMPIVQAKNILHGKIQPLSHKSRGLFRGIPQ
NTLITRYHSLVGRECDLPECLEITAKSSDGEIMAIEHKEYPLIGVQFHPESIGSTDGLKM
FSNFLHYKREETPILILLKKALQQQNFSFQEAYDMMDEITEGNLSEGQIASLLTSLEIKG
LNAQELAGFSSLLRNKSLEFPKPKRGEKRLDIVGTGGSMHKTFNVSTISSIILASMGVNV
LKHGNRAATSQCGSADLLEALGVNIQMSPEICIHCYEKLHFTFLFAQKFHYTLKKLATIR
KELGFKTLFNLIGPLINPSCNTHQILGVFDPKYTEVLAQTLQILGIQRALVVSGMDGYDE
ISLTTPTQITELHGKDQKTYLFTPQSLGLEYVDYAELKGGDVQKNRQIAWEILRAEPSPR
LDLVCMNAGAALYIYGEADSIKDGYLRIKEHLKTQKPKKTLEAFQKLSHQGR
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgcttattgataattatgattctttcacctacaacatctatcaagcattttgc
atgctgcatcaaaaagtcttggtagtgcgtagcgacaaaattacatgcgagcaaatccag
gaactaaacccaagccacatcatcatcggcccaggtcccaaaaccccaaaagaagcaggg
atttccatggaagtcattcagaagttttacaaaaaaatccccattcttgggatctgcctg
ggacatcaggccatcatggccagctttggcatgccaatcgtgcaggcaaaaaacatccta
catggcaagatacaacccctatcccacaaatcccgcgggctctttcgcggcatcccgcaa
aacacgctcatcacacgttatcactctctcgtgggcagggaatgcgatctgccagaatgc
ctggaaatcacagcaaaaagcagtgatggagaaatcatggcaatcgagcacaaagaatat
ccactcataggcgtgcaattccatccagaatccattggcagcacagatggtctgaaaatg
tttagcaatttcttgcattacaagcgcgaggaaacccccattttgatcctgctcaaaaaa
gccctgcaacagcagaattttagcttccaagaagcctatgacatgatggatgagatcaca
gagggcaatctctctgaaggccaaattgcctcacttctcacaagccttgagatcaaaggc
ctaaacgcccaagaacttgcaggctttagctctcttttgcgcaacaaatccctggaattc
cccaagcccaaaagaggagaaaagcgcttagatatcgtaggcactggagggagtatgcac
aagaccttcaatgtctccacgatctctagcatcattctggcaagcatgggcgtgaatgtg
ctcaaacacggcaatcgcgctgccaccagccaatgcggaagcgcagaccttttggaggca
ctgggggtcaatatccaaatgtcgccagaaatctgcatccactgctatgaaaaactacac
tttacttttttgtttgcgcaaaaattccactacacactcaaaaaactcgcaaccatacgc
aaggaattgggatttaaaacattattcaatctcatcggtccgctcatcaacccctcttgc
aacactcaccaaattttgggggtttttgatccaaaatacaccgaggtgctcgcccaaacc
ctgcaaatcctaggcatacagcgtgccctggtagtaagtggcatggatggctatgatgag
atttctctcaccactcccacacagatcaccgaattgcacggcaaggatcaaaaaacctat
ctcttcacaccccagagcctagggctagaatatgtagactatgcagagctcaaaggcgga
gatgtgcaaaaaaatcgccaaattgcttgggagatcttgcgcgcagagccttcccctagg
ctcgatcttgtctgcatgaatgctggcgcggcactctatatctatggggaggcggattct
atcaaagatggctacctgcgcatcaaagagcatctcaagacccaaaaacccaaaaaaacc
ctagaggcattccaaaaactaagccaccaaggccgataa

DBGET integrated database retrieval system