KEGG   Helicobacter mustelae: HMU09570Help
Entry
HMU09570          CDS       T01191                                 

Definition
(GenBank) putative multidrug-efflux protein
Organism
hms  Helicobacter mustelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_3 TauE HMA DUF4131 Wzz
Motif
Other DBs
NCBI-ProteinID: CBG40214
UniProt: D3UI91
LinkDB All DBs
Position
1092601..1093947
Genome map
AA seq 448 aa AA seqDB search
MSRQIFLLVIIISIRFFGLFIVLPVISLYAQSFENISALMVGLIIGGAYLTQLLFQTPLG
ILSDRYNRKIIIFIGLAIFLLGSVICAFAKTPEWLVVGRLIQGMGAVGGIVSAQITDITR
EEQRTKAMAVMGGCIFASFILAMIVGPIIGGHIGASWLFGITALFTFCSILLLYKVPQSP
KLTYSFDTKENTPKETRNKNLWIMNLSSFLEKALMTLVFVVVPLISFDHFHIIEQDLWKI
YVPSAILAIFAMGPASILAEKYNKPKLVLFLGISCFLLAYLLFAYSENILWMFVCGILIF
FVGFAMLEPIMQSLASKYAKAHLRGRALGNFTTASYLGSFVGGMFGAFAYHHLNFRVLAW
MIAVLCILWIGIIFFLRPPQKQKNLYLPLEENLRKILSLIGGLQGVIEVYINEGEKILII
KYDTDLIHAEQLEQQISELGKSHGKISN
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggcaaattttcttgcttgtcatcattattagcattcgatttttcgggcttttc
atcgtcttgcccgtgatctctttatatgcacaaagctttgaaaacatctctgctttgatg
gtggggctcattatcgggggagcctatctcacacagcttttgtttcagactcctttggga
attttaagcgatcgctacaatcgcaaaatcatcattttcatagggcttgcaatctttttg
ctcggctctgtaatctgcgcatttgcaaaaaccccagagtggctggtagtcggcagactc
atccaggggatgggcgcagtgggagggattgtgagcgcacaaatcactgacatcacccgc
gaagagcagcgcaccaaagcaatggcagtcatggggggctgcatctttgcaagcttcatc
ctagccatgatcgttgggcccatcatcggcgggcatatcggagcttcctggctttttggg
atcactgctttgtttactttttgctccatccttcttctctacaaagtcccacaaagccca
aaactcacctattcttttgacaccaaagaaaatactccaaaagaaacacgaaacaaaaat
ctctggattatgaaccttagctcctttttggaaaaggcactcatgactttggtgtttgtg
gtcgttccgctgatttcttttgatcatttccacatcatcgaacaggatttgtggaaaatc
tatgtcccaagcgcaatcctcgccatctttgccatgggccctgcaagcatcttggcagaa
aaatacaataagccaaagcttgtgctcttccttggcatctcctgcttcttgcttgcctat
cttctctttgcctattctgaaaatattttgtggatgtttgtttgcgggattttgattttt
tttgtgggttttgcgatgctagagcccatcatgcaatccctagctagcaaatatgcaaag
gcacatctgcgcggcagggctcttggaaatttcactacagcttcttatctaggatctttt
gtaggcgggatgtttggagcattcgcctatcaccatttgaattttcgagttttggcctgg
atgattgctgtgctctgcatcctatggattggcatcatcttcttcttgcgccccccacaa
aaacaaaaaaatctctacctcccgctggaggaaaatctaagaaagatcctctctctcatc
ggagggctgcagggtgtcatcgaggtttatatcaatgaaggtgaaaaaatcctgatcatc
aagtatgacacagacctcatccatgccgagcaactagagcaacaaatctcagaattagga
aaatcccatggaaaaatatcaaattag

DBGET integrated database retrieval system