KEGG   Helicobacter mustelae: HMU13380Help
Entry
HMU13380          CDS       T01191                                 

Gene name
ppc
Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hms  Helicobacter mustelae
Pathway
hms00620  Pyruvate metabolism
hms00680  Methane metabolism
hms01100  Metabolic pathways
hms01120  Microbial metabolism in diverse environments
hms01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMU13380 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    HMU13380 (ppc)
Enzymes [BR:hms01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HMU13380 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CBG40592
UniProt: D3UJB7
LinkDB All DBs
Position
complement(1452964..1455615)
Genome map
AA seq 883 aa AA seqDB search
MSDFEREKQFIMELMRKMLQSTDALAAEFFDAFILALNKQECTSSLLTQIIQNNKTLEVI
KAFSLYNILLNIIQERYNIKTAKPLQKIAQTYEELIAQGFDPEDIQEIINKMEFYPVFTA
HPTESRRRTFLEAHYAINRDLHKIFELHDEELIEDINYRLHLLWRTHLVRSQKLEVLFEL
DNLLYIIETSILNSAQKTLNMLSALLPKPLSKSPIRLGSWIGGDRDGNPFVSNELMTQVM
KTQHKLLINLYIKKVEKLIRELSISQDFCNISEELLRSIQREKEHLDSFRLYSKEPFRTK
LFLIKKKLQNRFIGINTNWREEFVYHSAKELLADIDLLIDSAPEHCTRSLKEFRNLVLLA
DFSLLHLDFREHKSVFQEAISEIFCLLGMCDNDFGSLSEEKKIEILNQALDSPKSILSEI
LPSLSRDTQNVIEIFVSIAWGKRHISEEILHSFILSMTTDASDLLTILWFIKQNRLWIPG
QSAQIAITPLFETIQDLKHSKEILLTLSKNPHYSLYLKDCASTQEIMVGYSDSSKDGGIF
ASNYNLHSAIYDLIKLGESLKITFKLFHGRGGSVSRGGGTLESALLAAPPRSVNGMLKVT
EQGEIIGSKYLSPMSADFNFANTLSALLKKSCLDAFCTHDIAHDDLDAKMCEITRSHRGQ
MQKISEQSYLKYRELVYGTAGFMDYFKAATPIEFIQQLNLGSRPSKRKDTAKVEDLRAIP
WVFAWTQNRSIIPAWYGLGSGLLAIEDKNALRQSYLESDFFRATIDNISQAFLKVDLEIA
GFYNAFIDDEALGNKIWGMIAEEYDKTMEYILWIRDESELLCSQPEIRKSILMRKPTVNA
LNLLQIELIKRYQKSHYEKQKTRLLEEIHSTIIGIAQGLRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactttgagagagaaaaacaatttattatggaattgatgcgcaagatgttgcag
agcacagatgctctagcggcggagttttttgatgcttttatcttggctttgaacaagcag
gaatgcacctcctccttgctcacccaaattatccaaaacaataaaacccttgaggtcatc
aaggctttttcgctctataatattttgctaaatatcatccaagagcgctataacatcaag
actgctaagcctctacaaaagatcgcacaaacctatgaggagcttatcgctcagggattt
gatccagaggacatccaagaaatcattaacaaaatggagttttatcctgtattcaccgcc
catcctacagaatctcgcaggcggacatttttggaagcacattatgccattaatcgcgat
ttgcataaaatttttgagttgcatgatgaagaactcatagaagacatcaattatcgcttg
catttgctttggcgcacccatttggtgcgcagtcaaaagctagaggtcttgtttgaattg
gataatttgctctatatcattgagacaagcatcctaaatagtgcgcaaaaaaccctaaac
atgctaagcgctcttttgccaaagcctcttagcaaatcccccatacgactgggcagctgg
attggtggggatcgtgatgggaatccatttgtaagcaatgaactcatgacacaagttatg
aaaacccaacacaagctccttatcaatctttatatcaaaaaagtagagaagctcattcgt
gagctctccatctctcaggatttttgcaatatttctgaggagcttttgagaagcatccag
agagaaaaagagcatttagatagctttagactctatagcaaagagccctttcgcaccaaa
ctctttttgatcaaaaagaaactccaaaatcgcttcataggcatcaataccaattggaga
gaggagtttgtctatcatagtgccaaggaattgcttgcagatattgatttattgatagat
agtgccccagagcattgcacgcgcagtctcaaagagtttcgaaatcttgttttgttagca
gatttttctttgttgcatttggattttcgcgagcataaaagtgtctttcaggaggcaatt
agcgagattttctgtctgcttgggatgtgtgataatgattttggatcccttagcgaagag
aaaaaaatagagattttaaatcaagcgctagattctcccaaatccattctctctgagatt
ttgcctagccttagcagggatacgcaaaatgtgattgagatttttgtctccattgcctgg
gggaagcgtcatatctcagaagagattctgcactcttttatcctttctatgactacagat
gctagtgatttattgaccatcctttggtttatcaagcaaaataggctttggatcccaggg
cagagtgcacagattgccattactccattatttgagacaatccaagatctcaagcattcc
aaagagattctcctcacccttagcaaaaatcctcactacagcctctatctcaaggattgc
gcatccactcaggaaatcatggtgggatattcagattccagcaaggatggggggattttt
gcaagcaattacaatcttcatagtgcaatctatgatctcatcaagcttggcgagagccta
aagataaccttcaagctcttccatggcaggggtgggagcgtgagccgtgggggtgggaca
ttagaatctgctctgcttgccgcaccccctaggagcgtgaatgggatgctcaaggtcaca
gagcagggcgagattattggctctaaatatctaagccccatgagtgcggattttaatttt
gccaatacattgagcgcattgctcaaaaaatcctgtcttgatgcattttgcacccatgac
attgctcatgatgacttggatgctaagatgtgtgagatcacaagatctcatagaggacag
atgcaaaaaatttcagaacaatcctatctcaagtatcgcgagcttgtgtatgggacagca
ggatttatggattatttcaaggctgccacccctattgaattcattcagcagctcaatctg
ggctcacgtcctagcaagcgcaaggacaccgccaaagtagaggatttgcgcgccattcct
tgggtgtttgcctggacgcaaaatcgcagcattattccagcatggtatggtcttggcagc
ggtctcttggcaattgaggacaaaaacgcattgcgtcagtcctatctagaatcagatttt
tttcgcgccacaattgacaatatttctcaagcctttttgaaggtggatttagagatcgca
ggattttataatgcatttattgatgatgaggccttggggaataagatctggggcatgatc
gcagaggaatatgacaaaaccatggaatacattctatggattcgcgatgaaagtgagctg
ctttgctctcagccagagattagaaaatccattctcatgcgcaagcccactgtaaatgca
ctcaatcttttgcagattgaactcatcaagcgctatcaaaaatcccattatgaaaaacaa
aaaacccgcctattagaggagatccatagcaccatcataggcatcgctcagggcctgcgt
aacacaggctag

DBGET integrated database retrieval system