KEGG   Halomicrobium mukohataei: Hmuk_2709Help
Entry
Hmuk_2709         CDS       T00982                                 

Definition
(GenBank) ABC transporter related
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
hmu  Halomicrobium mukohataei
Brite
KEGG Orthology (KO) [BR:hmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hmu02000]
    Hmuk_2709
Transporters [BR:hmu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    Hmuk_2709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_30 DUF4162 AAA_23 AAA_15 SRP54 AAA_29 AAA_22 AAA_27 AAA_24 AAA_33 Rad17
Motif
Other DBs
NCBI-ProteinID: ACV48815
UniProt: C7NZP7
LinkDB All DBs
Position
complement(2595995..2596891)
Genome map
AA seq 298 aa AA seqDB search
MIEARDLRKEYGDFVAVEGSTFSVDRGEVFGVIGPNGAGKTTTLKMLSGLLEPTSGDVSV
AGYDVTDTEMRQQLGFLPEESPLYEEMTPLSYLRFFADLYDVPTDVATERMHDTLDELEL
EHRERKLGDMSKGMKRKVAIARSLINDPDVLVYDEPASGLDPLTTNYVIQFTEQLAREGK
TIVFSAHNLYHVETICDRVAIMNEGQIVARGDLEALQDEYGDREYHVYTTVEVPGAVAEN
GNWRRVVETMDGVEDVRAAAAERGGEVIDIRTEESSLEEVFLNVAESETPGTRYVEEA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagctcgggaccttcgcaaggagtacggggacttcgtcgccgtcgaggggagc
acgttctccgtcgaccggggcgaggtgttcggcgtcatcggcccgaacggtgcgggcaag
acgacgacgctgaagatgctctccggactgctcgaaccgaccagcggcgacgtgtccgtc
gccggctacgacgtgaccgacaccgagatgcgccagcagctcggtttcctccccgaggaa
tcgcccctctacgaggagatgacgccgctgtcgtacctgcgattcttcgcggacctgtac
gacgtgccgacggacgtagcgaccgaacggatgcacgacacgctggacgagctcgaactc
gaacaccgcgagcgcaagctgggcgacatgtccaaggggatgaagcggaaggtcgccatc
gccagatcgctgatcaacgacccggacgtgctggtctacgacgaacccgccagcggactg
gacccgctgacgacgaactacgtcatccagttcaccgagcagctggctcgggagggcaag
accatcgtcttctcggcgcacaacctctatcacgtcgagacgatctgcgaccgcgtggcg
atcatgaacgagggccagatcgtcgctcgcggcgatctggaagctctccaggacgagtac
ggcgatcgggagtaccacgtctacacgaccgtcgaggtgcccggcgcggtcgcggagaac
ggcaactggcggcgcgtcgtcgagacgatggacggcgtcgaggacgttcgggcggccgcc
gccgaacgcggcggcgaggtcatcgacatcaggaccgaggagtcgagtctcgaagaagtg
ttcctcaacgtcgccgagagcgagacgccggggacccgctacgtcgaggaggcctag

DBGET integrated database retrieval system