KEGG   Halomicrobium mukohataei: Hmuk_2766Help
Entry
Hmuk_2766         CDS       T00982                                 

Definition
(GenBank) ribulose bisphosphate carboxylase, type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
hmu  Halomicrobium mukohataei
Pathway
hmu00630  Glyoxylate and dicarboxylate metabolism
hmu01100  Metabolic pathways
hmu01120  Microbial metabolism in diverse environments
hmu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Hmuk_2766
Enzymes [BR:hmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Hmuk_2766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACV48871
UniProt: C7P079
LinkDB All DBs
Position
complement(2657520..2658791)
Genome map
AA seq 423 aa AA seqDB search
MVGITYEDFLDLSYDPADSDLVCEFYVEPAADQDAESAASRVASESSNGTWAELQVDGGV
TDLSATACGIEAATAGDREGYRVTVAYPDALFEGGNMPQILSCIAGNILGMKAVDRIRLL
DCTWPEPLATSFAGPQFGTSVRSEIFDADDRPITATVPKPKVGLSTDQHAQIGYEAWTGG
LDLLKDDENLTDQAFNPFEDRLTESLAQRDRAVEETGEPKSYLLNVTAGGTEMLERVDMA
AEHGCEYVMVDVVTCGWAAVQQVRERCERHGLAIHAHRAMHAAFDRLPSHGVSMRVIAQI
ARLCGVDQIHTGTADLGKLANEDTVGINEWLTSDLYGLDDVLPMASGGLHPGLVPELVDR
CGTNIGIQAGGGVHGHPDGTHEGAKALRAAVEAAAEGRSIEAAADDEPALATALDKWGTE
TPR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggttggcataacctacgaagacttcctcgacctgtcctacgacccggccgactccgat
ctcgtctgtgagttctacgtcgaacccgccgccgaccaggacgcagagtcggcggccagc
cgggtcgcaagcgagtcctccaacggcacctgggcggaactccaggtcgacgggggcgtc
accgacctctcggcgacggcctgcggtatcgaggcggccacggccggcgaccgcgagggc
taccgcgtgaccgtcgcctaccccgacgcgctgttcgagggcgggaacatgccccagatc
ctctcctgtatcgccggcaacatcctcgggatgaaggccgtcgaccggatccgcctgctg
gactgtacgtggcccgaaccgctggcgacgagcttcgcgggcccgcagttcgggaccagc
gtccgctccgagatcttcgacgccgacgaccggccgatcaccgcgacggtcccgaagccg
aaggtcgggctctcgaccgaccagcacgcccagatcggttacgaggcctggaccggcggg
ctcgacctcctgaaagacgacgagaacctcaccgatcaggcgttcaaccccttcgaggac
cgcctgaccgagagtctggcccagcgcgaccgggcggtcgaggagacgggcgagccaaag
agctacctgctcaacgtcacggccgggggcaccgagatgctcgaacgcgtcgacatggcc
gccgaacacggctgtgagtacgtcatggtcgacgtggtgacctgcggatgggcggccgtc
cagcaggtccgcgaacgctgcgaacgccacgggctggcgatccacgcccaccgcgcgatg
cacgcggctttcgatcgacttccgtctcacggagtctctatgcgggtgatcgcccagatc
gcacgcctctgtggcgtcgaccagatccacaccggcaccgcggatctgggcaagctcgca
aacgaggacactgtcgggatcaacgagtggctcacgagcgacctgtacgggctcgacgac
gtgttgccgatggcctccgggggactgcatcccggcctcgttccggaactggtcgatcgc
tgcgggacgaacatcgggattcaggcgggcgggggcgtccacggccaccccgacgggacc
cacgaaggtgcgaaagctctccgtgcggccgtcgaagccgctgccgagggccgatcgatc
gaggccgctgccgacgacgagcccgcgctggcgacggctctcgacaagtggggcaccgag
acgcccaggtag

DBGET integrated database retrieval system