KEGG   Halothiobacillus neapolitanus: Hneap_0650Help
Entry
Hneap_0650        CDS       T01104                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hna00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Hneap_0650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hna01003]
    Hneap_0650
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hna01011]
    Hneap_0650
Enzymes [BR:hna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Hneap_0650
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Hneap_0650
Glycosyltransferases [BR:hna01003]
 Polysaccharide
  Bacterial polysaccharide
   Hneap_0650
Peptidoglycan biosynthesis and degradation proteins [BR:hna01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Hneap_0650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase UvrB_inter DUF3871
Motif
Other DBs
NCBI-ProteinID: ACX95503
UniProt: D0KYI0
LinkDB All DBs
Position
complement(702343..704835)
Genome map
AA seq 830 aa AA seqDB search
MPDAVKLVTNYGSSVSVWVNSVAQTKKTARPAQKPPARKGSNGKKPANNSASKGVRVGRF
SLRGLFWRIVIIAVLVLTALMSIWAYFLNQRVVDRFSGTLWKLPATVYAAPQEIYVGQHL
SPGELVDELTSLHYRDRDTLTETGTYDRVGNEIRLHRRAFDFPDGNETDRQIRVQFIDNR
VKAVNDDKGNSLGIIRLEPMTIGQLYPDINEDRVLLNVEQVQKDAPLLIKTLITVEDRDF
YYHHGVVPSAVLRALLVNIVSGHKVQGGSTITQQLAKNLFLTPKRTYKRKLEEMIMALEM
EWHYSKDKILEGYLNEVYLGQDGSRAIHGFGLAARYYFGRPVDELRPEEIALLVGMVKGA
SYYNPRRNPERAKDRRDTVIDLMANNGLISETEAGELKQKPLGVLKEKGTTSPHPAFLDL
VQRQLSQQYNPEDLKTKGLRIFTTMQPRVQAALEHSVTALNAIEKARHYKPDSLETAGII
TSIGTGEVEALIGGRNPTYEGYNRALDAQRQIGSLIKPTIYLTALSDPAKYSLITPLDDS
PLTVDQPGSKPWKPENYDRKFLGPTPLYTDLAESRNVPSIRLGLSVGLDNVSAMLHRLGG
PDIKPFYPSMLLGSMTMSPFNVAQIFQTLSSDGFYSPLRAIRSVVDAEGKPLTRYPLTVT
KVADPDALYLLQYAMQGVVNNGTARALNRTIPPSVGVAGKTGTTNDSRDAWFAGFTGNRV
GVIWVGRDDDKPTSLTGASGALPLWAAAFKPLYNKPRDMTPPKGIDFVNVDVAQQARVPS
QCPGILMPFMSGFEPKTILDCNGNSTDSGNTDRGGGTNGNPLNPILNFFR
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgccagatgctgttaaactggtcactaattatggttctagtgtatcagtgtgggtgaac
tcggtggcgcaaacaaaaaaaacagctcgaccagcccaaaaacccccagcccgcaaaggt
tctaacggtaaaaaaccagccaacaacagcgcttcgaagggcgttcgtgtgggtcgtttc
agcctgcgtggtcttttctggcgcatcgttattatcgctgtactggtgctcactgcgctg
atgagcatctgggcgtattttctgaatcaacgcgtcgtcgatcgcttttccggcacgctc
tggaagctgcccgccaccgtttatgccgcgccacaagaaatttatgtcggtcaacatctc
tcacccggcgaactggtggacgaactcaccagtctgcattatcgcgaccgagacacactc
accgaaacgggaacatatgatcgagtcggcaatgaaatccgcctgcaccgcagggcattc
gatttcccggatggcaacgaaacggacaggcagattcgggttcaattcatcgataaccgg
gtcaaggcagtcaacgacgacaagggcaacagcctcggtatcatccgcctggaaccgatg
acgatcggccaactctacccggacatcaatgaagaccgcgtgctgctcaatgtggaacag
gtacagaaagacgcgccgctcctgatcaagacgctcatcacggtcgaagatcgggatttt
tattatcatcacggcgtggtgccgagcgcggtcctgcgcgcgctgctggtcaatattgtc
agcggtcataaagtgcaaggcggcagcaccatcacccagcaactggccaagaatctgttt
ctcacgcccaagcgcacctacaagcgcaagctcgaagaaatgatcatggcgctggaaatg
gaatggcactactccaaggataaaatcctcgaaggttatttgaacgaggtgtacctcggt
caggacggcagccgcgccattcacggttttggcttggccgcgcgctattatttcggccgg
ccggtcgacgaactgcggcccgaggaaatcgccctgctcgtcggcatggtcaagggcgcg
tcgtactacaatccccgtcgaaaccctgaacgcgcaaaggatcgtcgtgacaccgtcatt
gatcttatggccaacaacggcctgatctcggaaaccgaagcgggcgaactcaaacaaaag
ccactgggcgtactcaaggaaaaaggcacgacctcgccccatcccgcgttcctggatctg
gtgcaacggcaactgtcgcagcaatacaaccccgaagacctcaaaaccaaagggttacgc
attttcaccaccatgcagccccgtgttcaggcagcgcttgagcactcggtcacagcactg
aatgcgattgaaaaagcccgtcattacaagcccgactccctggagaccgcgggcatcatc
acctcgatcggtaccggtgaagtcgaagcgttgatcggcgggcgcaatccaacctatgag
ggttacaaccgcgctttggatgcccagcgacagatcggctcgctgatcaaacccaccatt
tacctgacagcgctctccgatccggctaagtactcactgatcacgccactggacgacagc
cccttgaccgtcgatcagcccggctcaaaaccctggaaaccggaaaactacgaccgtaaa
ttcctcggccccacgccgctgtacactgatttggccgaatcgcgcaatgtgccgagtatc
cgtcttggcttgagcgttggcttggataatgtatcggccatgttgcaccgactgggcgga
ccagacatcaagccgttttatccctcgatgctgctcggctcgatgacgatgagtccattt
aatgtcgcacaaatcttccaaacgctctcctcagacggcttttacagtccgctgcgcgcc
attcgcagtgtggtggatgccgaaggcaaaccgctgacgcgttacccgctgaccgtcacc
aaagtggccgatcccgatgcgctctatctgctgcaatacgccatgcaaggtgtggtgaat
aacggcacggcacgcgccttgaaccgcaccattcccccgtcggtgggtgtagccggcaag
acaggtaccaccaacgacagccgggatgcctggttcgccggctttacgggcaatcgggtc
ggggtaatttgggtcggtcgcgatgacgacaagcccaccagcctgaccggtgccagcggt
gcattgcctttatgggcagcggcattcaaaccgctctacaacaagccacgggacatgaca
ccgcccaaaggcatcgatttcgtcaatgtcgatgtggcgcagcaggcgcgcgttcccagc
cagtgccccggcatcctgatgccatttatgagcggtttcgaacccaaaaccattctcgat
tgcaacggcaactcgaccgactccgggaataccgatcggggcggcgggacaaacggcaat
ccactcaacccgattttgaattttttccgataa

DBGET integrated database retrieval system