KEGG   Halothiobacillus neapolitanus: Hneap_1244Help
Entry
Hneap_1244        CDS       T01104                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00970  Aminoacyl-tRNA biosynthesis
hna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hna00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Hneap_1244
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hna03029]
    Hneap_1244
Enzymes [BR:hna01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Hneap_1244
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Hneap_1244
Mitochondrial biogenesis [BR:hna03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Hneap_1244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ACX96080
UniProt: D0L057
LinkDB All DBs
Position
complement(1349882..1351360)
Genome map
AA seq 492 aa AA seqDB search
MSSMNGWETVIGLEIHAQLATKSKIFSGASTAFGAEPNVQACAVDLGLPGVLPVLNAEAV
HMAALFGLAIGAHVAPVSTFDRKNYFYPDLPKGYQISQLAQPIVSGGSVTITTGEGEKAV
NKTINLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLIEIVSEPEMRSSAEAVAYARKV
HAIVQYLGICDGNMQEGSFRVDANVSVRPKGETKLGTRTEIKNVNSFRFLERAIDYEITR
QIELIEDGGTVQQQTRLYDPDKDETRMMRTKEAADDYRYFPDPDLLPVVIDQALLAEWKA
SLPELPDAKAARYQSDYGLSPYDAGVLTSARAIATYFEQTLNSMGAAADAKLCANWVTGA
LAAQLNKANLGIEQSPVSSDALAGLLLRVADNTLSNKLAKEVFDAMWAGEGDADSIIDAR
GLKQITDSSAIEAMVDEILAANPGKVAEYRSGKDKLFGFFVGQVMKAAQGKANPQQLNEV
LKARLGPSEGSS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcatgaacggatgggaaacggttatcgggcttgagattcacgcgcaactggcc
acgaaatcgaaaatattttccggcgcgtcgactgccttcggtgccgaaccgaatgtgcag
gcttgtgcggtcgatctgggcttgccgggtgttttgcccgtactgaatgccgaagcggtg
cacatggcagcgttatttggcttggcgatcggtgcgcatgtggcgccggtatcgacgttt
gatcgcaagaattatttctacccggatttgcccaagggctatcagatcagtcagctggca
cagccgattgtcagcggcggctcggtcacaatcactaccggtgagggcgaaaaggccgtc
aacaagacgatcaatctaacccgcgcgcatctagaagaagatgcgggcaagagcctgcat
gaggattttgcgggcatgaccggtatcgacttgaatcgtgcgggcacgccgttgatcgaa
atcgtctccgagccggaaatgcgttcctcggccgaagcggtggcctatgcccgcaaggtc
catgcgattgtgcaatatctcgggatttgtgacggcaacatgcaggaaggctcgttccgc
gtggatgccaatgtttccgttcgcccgaaaggtgaaacgaagctgggtacgcgcacggaa
atcaagaacgtgaactccttccgcttccttgagcgggcgatcgattacgagatcacccgt
cagatcgaattgatcgaagatggtggtacggtgcagcagcaaacacggctgtacgatccg
gataaggatgagactcgcatgatgcgtaccaaggaagcggcggacgattatcgctatttc
cccgatccggacttactgcccgttgtgatcgaccaggctctgttggccgaatggaaggcc
agcctgccggaactgccggatgccaaggccgcccgataccaaagcgactatggcctctca
ccctatgatgccggcgtgctcaccagcgcgcgggcgattgcgacgtacttcgagcagacg
ctgaatagcatgggtgccgccgccgatgccaaactctgtgccaactgggtgaccggtgca
ttggccgcccagctcaataaagcgaaccttgggattgaacaaagcccggtatcgtccgat
gcattggccgggctcttgttgcgtgtggcagacaatacgttgtcgaacaagctcgctaag
gaagtcttcgatgccatgtgggcgggtgagggcgatgccgattcgattatcgacgcacgg
ggcttgaagcagattaccgacagttcggcgatcgaagccatggttgacgagatattggca
gcaaacccgggcaaggttgccgaataccgcagtggcaaggacaaactgtttgggttcttc
gtcggtcaggtgatgaaggccgcccaaggcaaggcgaatccccaacagctcaatgaggtg
ctcaaagcacggctgggtccttcggagggttcttcatga

DBGET integrated database retrieval system