KEGG   Halothiobacillus neapolitanus: Hneap_1748Help
Entry
Hneap_1748        CDS       T01104                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hna  Halothiobacillus neapolitanus
Brite
Enzymes [BR:hna01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Hneap_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACX96571
UniProt: D0L1J8
LinkDB All DBs
Position
complement(1876184..1876792)
Genome map
AA seq 202 aa AA seqDB search
MAFQLPELSYDYGALDKSIDAQTMEIHYSKHHGAYVTNCNNAIAGTEWDDKSIEEIMANV
SKLPPAVRNNGGGHFNHALFWSILSPNGGDAPSGDLADDINATFGSFSALKDQMSTAGAT
RFGSGWAWLILDAQGKLAVCSTPNQDNPTMDIAEIKGTPILGIDVWEHAYYLRYQNRRPD
YLKAIWDVISWDAVGDRYAAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttttcaactcccggaactcagctacgattacggcgcactcgataaatccatcgat
gcgcaaaccatggaaattcactacagcaagcaccacggcgcgtatgtgaccaactgcaac
aatgccatcgccggcaccgaatgggatgacaagtccatcgaagagatcatggcgaatgtg
tccaaactcccgccagccgtgcgcaacaatggcggcggacacttcaatcatgcgctgttc
tggtcgattctctccccgaacggtggtgatgcgccatcaggcgatctggccgatgacatc
aacgccacgttcggttccttcagtgcattgaaagatcagatgagcaccgctggcgccacg
cgttttggttccggctgggcctggttaattttggacgcacagggcaaactcgccgtctgc
tcaacgccgaatcaggacaaccccaccatggacatcgccgagatcaagggcacgcccatc
ctcggtattgatgtgtgggaacacgcatactatctgcgttaccagaaccgccgcccggat
tacctcaaggccatctgggatgttatcagttgggatgcggttggcgatcggtacgctgct
gcgaagtaa

DBGET integrated database retrieval system