KEGG   Halothiobacillus neapolitanus: Hneap_1851Help
Entry
Hneap_1851        CDS       T01104                                 

Definition
(GenBank) A/G-specific adenine glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:hna00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Hneap_1851
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hna03400]
    Hneap_1851
Enzymes [BR:hna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     Hneap_1851
DNA repair and recombination proteins [BR:hna03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Hneap_1851
 Prokaryotic type
     Hneap_1851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HhH-GPD NUDIX_4 HHH HHH_5
Motif
Other DBs
NCBI-ProteinID: ACX96673
UniProt: D0L1V0
LinkDB All DBs
Position
complement(1986171..1987316)
Genome map
AA seq 381 aa AA seqDB search
MSASDFHSRLLDWFDRHGRHDLPWQHPRTPYRVWISEIMLQQTQVATVIGYFNRFMQRFP
SLDVLAAAPVDEVLALWSGLGYYARARNLHAAAQIMAQQGVPETRAGWQALPSVGPSTAA
AIMAQAFDVPETILDGNVKRVLARHAGIDRPIEQASTIQALYEVAKLHTPQTRVADYTQA
IMDLGATLCTRHSPGCSACPVSADCVAFASNRVESLPVRRRRQPVPTRRAVFMAIEDEAE
RLMLIRRPPTGIWGGLWCLPEYIPADDCVSQEHTLDSAVSGKQAKDNSGQQSMLSIHRLK
QRGPTSPLTTFEHRFTHYLLDARIDHMVVSRTSSVEDNPDVLWLPLIELAARAPLLGLPK
PMSRFLSDYPALKSSQSSCTP
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaagcgattttcacagccgcctgctcgactggttcgatcggcacggccggcac
gatttgccctggcagcatcccaggacaccctaccgcgtctggatctccgagatcatgttg
cagcaaacgcaagtggcgacggtgatcgggtatttcaatcgattcatgcagcgcttccca
tcgttggacgtattggctgccgcaccggtggatgaggtgttggcgttgtggtctggactt
ggctattacgcccgcgcccgcaatctgcacgccgccgcgcaaatcatggcgcagcaaggc
gttccagaaacgcgcgccggttggcaggcattgcctagtgtagggccttccacagccgct
gcgatcatggcgcaggcattcgatgtgccggaaacgattctggatggaaacgttaaacgc
gtgctggcacgccatgccggtatagatcgtcccatcgagcaggcttcgactattcaggcg
ctgtacgaagttgccaaattacatacgccgcagacccgcgtggccgattacacgcaggct
attatggatctcggtgcaaccctgtgcacacgccattcgccgggatgctcggcttgcccc
gtttctgcggactgcgtggcgttcgcgtccaatcgggttgaatccttgcccgttcggcgc
aggcgtcaacccgtgccgacccgtcgtgctgtcttcatggcgatcgaggatgaagcggaa
cgcctgatgctgattcgccgtcctccgacggggatctggggtgggttgtggtgtctgccc
gagtatattcccgccgatgactgtgtgtcgcaggaacacacactcgattcggccgtttca
ggtaaacaggcgaaagataattcaggccagcagtcgatgctttcgatacatcggctgaaa
cagcgcggcccaacttcgcccttgacaacattcgaacatcgattcacgcattatttgctc
gatgcccgcattgatcacatggtggtttctcgcacatcgagcgtcgaggacaatcccgat
gtgctctggttgccattgattgagttggcagcgcgcgcgccgcttttggggttgcccaaa
ccaatgagccgttttttgtcggactatccggcgctgaagtcatcccagagttcatgcacg
ccataa

DBGET integrated database retrieval system