KEGG   Halothiobacillus neapolitanus: Hneap_1936Help
Entry
Hneap_1936        CDS       T01104                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
hna  Halothiobacillus neapolitanus
Pathway
hna00550  Peptidoglycan biosynthesis
hna01100  Metabolic pathways
hna01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hna00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Hneap_1936
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Hneap_1936
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hna01003]
    Hneap_1936
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hna01011]
    Hneap_1936
Enzymes [BR:hna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Hneap_1936
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Hneap_1936
Glycosyltransferases [BR:hna01003]
 Polysaccharide
  Bacterial polysaccharide
   Hneap_1936
Peptidoglycan biosynthesis and degradation proteins [BR:hna01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Hneap_1936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ACX96758
UniProt: D0L235
LinkDB All DBs
Position
complement(2069506..2071878)
Genome map
AA seq 790 aa AA seqDB search
MKLIKFVVYVFGFLLIFSVGGVGILYQIYNNQLPDVQDLAAVQYQIPMRIYDADGGLIAE
FGEKRRFPVTYAELPKVVVDAFTSAEDGGFFEHGGVDVQSLFRAAYELVKTGHKGQGGST
ITMQVARNFFLGRQKTYSRKLMEILLAIKIEHTLSKEQILTLYLNKIFLGNRTYGVKAAA
QVYFGKSLDKLTVAEAAMLASLPKAPSSVNPVSNPDKALARRAYVLGRMLALGKIDQASY
DQAMQEPLPGHLFASSEIQTRAPFVAEMIRQKLFAQYGEKAYEMGLVVHTSINPKAQQVA
RMSLRDGLIAYDRRHGYRGAEDHWGSLLSDPKALLDKLQDTPVVGGLIPAVVLSVDPKTA
VVLMPDGSKNSLGMDAVSWACRYESTDHCGPKPKLMGDVLKAGDLIRLQAEADQHWMLAE
IPAASAGFVALDPETGAIRALVGGFDFAHDSKFNHVTQAERQPGSGFKPFLYSAALDHGF
TLATMINDSPVVVKNGVKEGVDWRPQNYEKHFGGPMRLRMALVHSVNLVSIRLIEALGPE
NVLKYASRFGLPTQNWSPTPSMALGSYTLTPLELVGGFSAFVNGGFRITPYVITEVDNGD
NAVLYSHPSVNLCDTCPMDSPDPSVAPRIITPQNAFLMRSALRDVVRMGTGVRAYRALKR
DDIGGKTGTTNEQRDAWFTGFGPGWVATAWVGFDDNSPLGHREVGGTAALPIWTDFMKVM
LPPPTDKPHVPPPGVTEVMINPDTGNRLPKGASGGVREYFDTTRGPADESGLSAPIPADV
VPQNLMNDLF
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttatcaaatttgttgtgtatgtgtttggttttttgttgattttttccgtcggc
ggggtgggtatattgtatcaaatatacaacaatcaactgcctgatgttcaggatctggcg
gcagtccaataccaaattccgatgagaatttacgacgctgacgggggtttgatcgccgaa
tttggtgaaaaacgccgcttcccggttacctacgctgaattgcctaaagttgtcgtcgat
gcgttcacatctgcggaagatggtggtttttttgaacatggtggcgtggatgttcaaagc
ctgttccgcgctgcttatgagttggtcaagacgggtcacaaaggacaaggtggctcaaca
atcacgatgcaggtcgcccgcaatttctttttgggtaggcagaaaacctatagccgcaaa
ttgatggaaatccttttggcgatcaagatagagcacacattgagcaaggagcagattctc
acgttgtatctgaacaaaatatttctgggaaatcggacatatggcgtcaaggccgctgcc
caggtttattttggcaagtcactggataagttgacggtcgctgaggccgctatgctggcc
tcattgcccaaggctccttcgtccgtgaatcctgtttccaatcccgataaggcgttagcg
cggcgcgcttacgtgcttgggcgcatgcttgcgcttgggaaaatcgatcaagcttcttat
gatcaggccatgcaagaacccctaccgggacacctttttgcgagttctgaaatacaaaca
cgtgcaccgttcgtagcagaaatgatccgccaaaaattgtttgcccaatatggtgagaag
gcatacgaaatggggcttgttgttcacacctcaatcaatccgaaggcgcagcaagtagcg
cgaatgtcactcagagatggtctgatagcttatgaccgccgtcacggttatcgcggtgcg
gaggatcattggggatcgttgctttccgaccctaaagcgcttttggataaactccaggat
acgcctgtggtcggtgggttgattccggcggtggttttgtcggttgatcctaaaacggct
gttgttttgatgcccgatggttcaaaaaacagtctgggaatggatgcggtcagttgggct
tgtcgttacgaatcgacggaccattgcggtcccaagccgaagctgatgggtgatgtgctc
aaggcgggtgatttgattcgtttgcaggccgaggctgaccagcattggatgcttgcagaa
ataccggcggccagcgcgggctttgtcgcgttggaccccgaaacgggggctattcgcgca
cttgtcggcggtttcgatttcgcgcatgacagcaaattcaatcacgtaactcaggcggag
cgtcagccaggatcaggtttcaagccattcttgtattcagctgctctggatcatggtttt
accttggcaacgatgatcaacgattcgccggtggtagttaagaacggtgttaaagaaggg
gtcgattggcgtccgcagaattatgaaaagcacttcggtggcccaatgcgtttgcggatg
gccttggtgcattccgtcaacttggtgtcgatccgtttaattgaagcactcgggcccgaa
aatgtactcaaatatgccagtcgttttgggctgcccactcaaaattggtcgcctacccct
tcaatggccttgggtagttataccttgacaccattggagctggttggcggcttctctgcg
tttgtgaatggtgggttccggattacaccctatgtcattaccgaggtcgacaacggagat
aacgcggtgctttatagccatccctcggttaatttgtgcgatacctgcccgatggactcg
cccgatccgagtgtcgcgccgagaataattaccccgcaaaatgcgttcttgatgcgttct
gctttacgtgatgtggtgcggatgggtacgggggttcgcgcctatcgtgccctgaaacga
gatgatattggcgggaaaacaggcacaaccaacgagcaacgtgatgcctggttcacgggt
ttcgggccgggttgggtcgccacggcgtgggtcggtttcgatgacaactcaccattgggg
catcgcgaagttgggggtactgcggctttacccatctggactgatttcatgaaggtcatg
ctgccaccgccgacggataagccccatgtgccaccgcccggtgtgaccgaggtcatgatc
aatcctgatacgggaaatcggttgccaaaaggcgcttctggtggcgtgcgtgagtatttc
gatacaacacgtggtcctgcggatgaatccgggctctccgccccgattccggcggacgtg
gtgccgcagaatctgatgaatgatttgttttga

DBGET integrated database retrieval system