KEGG   Hyphomonas neptunium: HNE_3245Help
Entry
HNE_3245          CDS       T00397                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
hne  Hyphomonas neptunium
Pathway
hne00020  Citrate cycle (TCA cycle)
hne00190  Oxidative phosphorylation
hne00650  Butanoate metabolism
hne01100  Metabolic pathways
hne01110  Biosynthesis of secondary metabolites
hne01120  Microbial metabolism in diverse environments
hne01130  Biosynthesis of antibiotics
hne01200  Carbon metabolism
Module
hne_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hne_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hne_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HNE_3245 (sdhA)
   00650 Butanoate metabolism
    HNE_3245 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HNE_3245 (sdhA)
Enzymes [BR:hne01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HNE_3245 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     HNE_3245 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 DAO FAD_oxidored HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABI76397
UniProt: Q0BX75
LinkDB All DBs
Position
3413339..3415126
Genome map
AA seq 595 aa AA seqDB search
MSSYNWIDHTYDVVVVGAGGSGLRAALGAAQAGLRTACITKVFPTRSHTVAAQGGIAASL
GNMSDDSWQWHMYDTVKGSDWLGDQDAIEYLVRNAPDAVYELEHWGMPFSRTEEGKIYQR
AFGGMTRNFGEGPVQRTCAAADRTGHAMLHTLYGQCVREETEFFIEYFALDLIMDDDGVC
RGVTAWKLDDGTLHRFRAQKTILATGGYGRAYFSCTSAHTCTGDGNAMVLRAGLPLQDME
FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRAMTMEI
RDGRGVGPEKDHIFLHLNHLAPETLHERLPGISETAKIFAGVDVTKEPIPVLPTVHYNMG
GIPTNFHGEVLTKKNGDPDAVVPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAGLR
CGATTEAGARQPGLAKTATDSHIARLDKMRNATGDQPVAKLRLEMQRAMQSNCAVFRTGS
VLKEGVDAIEDVYKKLPGIDVKDRGMVWNTDLVEALEFENLICQAAVTVNSAANREESRG
AHAREDFADRNDETWMKHTLAWCDDAGKVSLDYRPVHEYTLSNEIEYIKPKARVY
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgagcagctataactggattgatcatacctacgacgtggtcgtggtcggcgccggcggc
tccggtctccgcgcagcccttggcgccgcgcaggcgggcctgcgcacggcctgtatcacc
aaggtcttccccacccgctcccacaccgtggcagctcagggcggcatcgccgcctcgctc
ggcaacatgtccgacgacagctggcagtggcacatgtacgacaccgtcaagggctccgac
tggctcggcgaccaggacgcgatcgaatatctcgtgcgcaacgcgcctgacgcggtttac
gaacttgagcattggggcatgcccttctcgcgcaccgaggaaggcaagatctaccagcgc
gctttcggcggcatgacccgcaatttcggcgaaggccccgtccagcgcacctgcgcggcg
gcagaccggaccggccacgccatgctgcacaccctctatggccagtgcgtgcgcgaagag
accgaattcttcatcgagtatttcgcccttgatctgatcatggatgatgacggcgtctgc
cgcggtgtcaccgcctggaaactcgacgatggcacgcttcaccgcttccgcgcccagaaa
accatcttggcaaccggcggctatggccgcgcctatttctcctgcacctcggcccacacc
tgcaccggcgatggcaatgccatggtcctgcgcgccggtctgccgcttcaggacatggaa
ttcgtccagttccaccccaccggcatctacggctcaggctgcctgatcaccgaaggcgcc
cgcggcgaaggcggctatctgacaaactccgaaggcgaacgcttcatggagcgctatgcg
ccatccgccaaagacctcgcctcgcgcgatgttgtcagccgcgcgatgaccatggaaatc
cgcgacggccgcggcgtcgggccggagaaagaccacatcttcctccacctgaaccacctc
gcgcctgaaaccctgcatgagcgccttccgggcatctcggaaaccgccaagatctttgcc
ggcgtcgacgtcaccaaggagccgatcccggttctgccgaccgtccactacaatatgggc
ggcatcccgacgaacttccacggcgaagtcctcaccaagaagaacggcgatcccgacgcg
gttgtccccggcctgatggctgtgggcgaagcggcctgtgtgtccgtacacggcgcaaac
cgcctcggctccaactcgctgatcgacctggtcgtgttcggccgcgccgccggtctgcgc
tgcggcgccaccaccgaggcaggcgcccgccagcccggactcgccaagaccgcaaccgac
agccacatcgcccgcctcgacaagatgcgcaacgccaccggcgaccagccggttgccaag
ctccgcctagaaatgcagcgcgcgatgcagtccaactgcgccgtgttccgcacaggctcg
gtgctgaaagagggcgtcgacgcaatcgaggacgtctacaagaaactgccgggcatcgat
gtcaaagatcgcggcatggtctggaacacagatctcgttgaagcgctcgaatttgaaaac
ctgatctgccaggcggccgtgacggtgaattcggccgcaaaccgggaagaaagccgcggc
gctcatgcccgcgaagatttcgccgaccgcaacgacgagacatggatgaaacacaccctc
gcctggtgcgacgatgccggtaaggtctcgctcgattaccgcccggttcacgaatacacg
ctctccaacgagatcgagtacatcaagccaaaagcgcgggtatactga

DBGET integrated database retrieval system