KEGG   Hyphomonas neptunium: HNE_3247Help
Entry
HNE_3247          CDS       T00397                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
hne  Hyphomonas neptunium
Pathway
hne00020  Citrate cycle (TCA cycle)
hne00190  Oxidative phosphorylation
hne00650  Butanoate metabolism
hne01100  Metabolic pathways
hne01110  Biosynthesis of secondary metabolites
hne01120  Microbial metabolism in diverse environments
hne01130  Biosynthesis of antibiotics
hne01200  Carbon metabolism
Module
hne_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hne_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hne_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HNE_3247 (sdhB)
   00650 Butanoate metabolism
    HNE_3247 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HNE_3247 (sdhB)
Enzymes [BR:hne01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HNE_3247 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     HNE_3247 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer2 Fer4_18
Motif
Other DBs
NCBI-ProteinID: ABI78245
UniProt: Q0BX73
LinkDB All DBs
Position
3415494..3416276
Genome map
AA seq 260 aa AA seqDB search
MVQLTLPQNSKVKKGKTWPKPQGATNLRAFKIYRFSPEEGGNPRWDTYWVDMDRAGTMIL
DVLIYIKNNIDPTLAFRRSCREGVCGSCAMNIAGRNTIACTKGFEELPSGEVIIAPLPHQ
PVVKDLIPDLTNFYAQHAYVQPFLRTSTPTPEKEWRQSAEDRTKLDGLYECILCASCSTS
CPSYWWNGDKYLGPAALLQAYRWLIDSRDEATGERLDDLEDPFKLYRCHTIMNCTQVCPK
GLNPAEAIAKIKHMMVERVA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtacagctgacccttccccagaactcgaaggtcaaaaaaggcaagacttggcccaag
ccccagggcgcgaccaatctgcgcgctttcaagatctaccggttcagccctgaagagggc
ggcaatccgcgctgggacacctattgggtggatatggaccgcgccggcacgatgatcctc
gacgtgctgatctacatcaagaacaacatcgacccgaccctcgccttccgccgctcctgc
cgcgaaggcgtgtgcggttcctgcgcgatgaacattgcgggccgcaacacgattgcctgc
accaagggctttgaagaacttccctccggcgaagtcatcatcgcgcccctgccccaccag
cccgtcgtcaaggacctgatcccggacctgacgaacttctacgcccagcacgcctatgtg
cagcccttcctgagaacctccacgcccacgccggagaaggaatggcgccagtcggccgaa
gaccgcaccaagctcgacggcctctatgagtgtatcctgtgcgcctcctgctccacctcc
tgcccatcctattggtggaatggcgacaaatatctcggccctgccgcgcttctgcaggct
tatcgctggctgatcgacagccgcgacgaagccaccggcgaacgccttgacgatctggaa
gatcccttcaagctctatcgctgccacacgatcatgaactgcacgcaggtctgcccgaaa
ggcctcaaccccgccgaggccattgccaagatcaagcacatgatggtcgagcgcgtggcg
taa

DBGET integrated database retrieval system