KEGG   Hyphomicrobium nitrativorans: W911_00910Help
Entry
W911_00910        CDS       T02943                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
hni  Hyphomicrobium nitrativorans
Pathway
hni00061  Fatty acid biosynthesis
hni00780  Biotin metabolism
hni01100  Metabolic pathways
hni01130  Biosynthesis of antibiotics
hni01212  Fatty acid metabolism
Module
hni_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hni00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    W911_00910
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    W911_00910
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    W911_00910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hni01004]
    W911_00910
Enzymes [BR:hni01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     W911_00910
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     W911_00910
Lipid biosynthesis proteins [BR:hni01004]
 Fatty acid synthase
  Component type
   W911_00910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AHB47286
UniProt: V5S964
LinkDB All DBs
Position
complement(198601..199485)
Genome map
AA seq 294 aa AA seqDB search
MTEFDPSKAGPLLAGKRGLIMGVANDRSIAWGIARALAGQGAELAFSYQDGAFGRRAVPL
AQSLGSKIIEPANVLDLATIDNVFARIKDEWGSLDFVVHALAFSDPRELAGRYVNTTRDN
FTNTMVISCFSFTEIAQRAMALMPNGGSLLTLSYGGATRSVPSYNVMGVAKAALEASVRY
LAADLGPQGIRVNALSAGPMRTLSGAGVSDARVIFNFQKENAPLRRTPSLNDVGGSALYL
ISDLSAAVTGEVHFVDCGYSTISMPTLDALKAAEHPAETQQPAPSGRSPSEAAE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatttgatccttcgaaagcaggcccccttctggccggtaagcgcggcctgatc
atgggcgtcgccaacgaccgttcgattgcctggggcattgcccgggcgctcgcggggcag
ggcgcggagctggcattcagctatcaggacggcgctttcggccgccgcgcggtgccgctc
gcccagtcgctgggctccaagatcatcgagccggcaaacgtgctcgacctcgccaccatc
gacaacgtgttcgcacgcatcaaggacgagtggggcagcctcgacttcgtcgtccacgcc
ctcgccttctccgatccgcgcgagcttgcgggccgctacgtcaacaccacgcgcgacaac
ttcaccaacaccatggtgatctcgtgcttctcgttcaccgagatcgcgcagcgggccatg
gcgctgatgccgaacggcggctcgctcttgacgctgagctacggcggcgccacgcgttcg
gtgccgtcctacaacgtgatgggcgtcgcgaaggccgctctcgaagcctccgtgcgctat
ctcgcagccgacctcggtccgcagggcatccgcgtcaacgcgctttcggcgggccccatg
cgcacgctttcgggcgccggcgtttccgacgctcgcgtgatcttcaacttccagaaagag
aacgcccctctgcgccggacgccgagcctcaacgacgtcggcggctccgcgctctatctc
atctcggatctctcggctgccgtaacgggcgaagtgcatttcgtcgattgcggctacagc
accatctccatgccgacgctcgacgcgctgaaggcggccgaacacccggccgagacgcag
cagcccgcgccgtccggacggtctccgtcggaagccgccgagtag

DBGET integrated database retrieval system