KEGG   Hyphomicrobium nitrativorans: W911_02265Help
Entry
W911_02265        CDS       T02943                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
hni  Hyphomicrobium nitrativorans
Pathway
hni00020  Citrate cycle (TCA cycle)
hni00190  Oxidative phosphorylation
hni00650  Butanoate metabolism
hni01100  Metabolic pathways
hni01110  Biosynthesis of secondary metabolites
hni01120  Microbial metabolism in diverse environments
hni01130  Biosynthesis of antibiotics
hni01200  Carbon metabolism
Module
hni_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    W911_02265 (sdhB)
   00650 Butanoate metabolism
    W911_02265 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    W911_02265 (sdhB)
Enzymes [BR:hni01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     W911_02265 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     W911_02265 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_7 Fer4_9 Fer2
Motif
Other DBs
NCBI-ProteinID: AHB47495
UniProt: V5SBT4
LinkDB All DBs
Position
496175..496954
Genome map
AA seq 259 aa AA seqDB search
MVQLTLPKNSKIQKGKTWNSPDVKGAWREVRVYRWDPDTGENPRVDTYWIDTEQCGPMVL
DALIKIKNEIDPSLTFRRSCREGICGSCSMNIDGMNDLACLKGLDEITGPINIYPLPHLK
VVKDLVGDLTNFYAQHRSIEPWLKTDTATPPKEWKQSRDDREKLDGLYECILCACCSTAC
PSYWWNSDRYLGPAALLQAYRWVIDSRDEATGDRLDNLEDPFRIYRCHTIMNCAKTCPKG
LNPAKAIAELKKLMVQRRV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggtccaactcacgcttcccaaaaattcaaagattcaaaagggcaagacgtggaattct
cccgacgtcaagggagcgtggcgcgaggtgcgggtttatcgctgggatccggatacgggc
gaaaatccgcgtgtcgatacctattggatcgacaccgagcagtgcgggccgatggttctc
gacgcgctcatcaagatcaagaacgagatcgatccgtcgctgaccttccgtcggtcgtgc
cgcgagggaatctgcgggtcgtgctcgatgaatatcgacgggatgaacgatctcgcgtgt
ctcaagggtctcgacgagatcacggggcccatcaacatctatccgctgccgcatctcaag
gtggtcaaggacctggtcggcgatctgacgaatttctatgcccagcaccgttcgatcgaa
ccgtggctcaagaccgatacggcgacgccgcccaaggaatggaagcaatcgcgcgacgac
cgcgaaaagctcgacgggctttacgagtgcatcctgtgcgcctgctgctcgacggcgtgc
ccgagctattggtggaactcggaccgctatctgggtccggcggcgttgctccaagcctat
cggtgggtgatcgacagccgcgacgaggcgaccggcgaccggctggacaaccttgaggat
ccgttccggatctaccgctgccatacgatcatgaactgcgccaagacgtgccccaagggg
ctgaacccggcgaaggcgattgccgagctcaagaagctgatggtgcagcggcgggtgtaa

DBGET integrated database retrieval system