KEGG   Hyphomicrobium nitrativorans: W911_12740Help
Entry
W911_12740        CDS       T02943                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
hni  Hyphomicrobium nitrativorans
Pathway
hni00010  Glycolysis / Gluconeogenesis
hni00620  Pyruvate metabolism
hni01100  Metabolic pathways
hni01110  Biosynthesis of secondary metabolites
hni01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    W911_12740
   00620 Pyruvate metabolism
    W911_12740
Enzymes [BR:hni01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     W911_12740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AHB49076
UniProt: V5SDX6
LinkDB All DBs
Position
2652124..2653644
Genome map
AA seq 506 aa AA seqDB search
MIQQALNELSQQIRIRPRYDNFIGGQWVAPVKGQYFTNVTPVTGKPLCDVARSTAEDIEV
ALDAAHKARADWGNASPATRAGVLLKIADRMEANLKLIAMVETLDNGKPIRETTAADIPL
AIDHFRYFAGCLRAQEGSIAEIDHDTVAYHFHEPLGVVGQIIPWNFPLLMACWKLAPALA
AGNCVVLKPAEQTPMSIMVLMDLIGDLLPPGVLNVVNGFGIEAGKPLAQNKRIAKIAFTG
ETTTGRLIMQYASENIIPCTLELGGKSPNIFFADVADHDDDFFDKALEGFAMFALNQGEV
CTCPSRALVHESIYDRFMERAVKRVEAIKQGHPLDSSTMIGAQASNDQLEKILSYIKIGQ
DEGAQVLTGGARNILDGEAAEGYYVKPTILAGHNKMRVFQEEIFGPVVSVTTFKDDEEAL
AIANDTLYGLGSGVWTRNGTRAYRFGRAIQAGRVWTNCYHLYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNMLVSYSPKALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatccaacaagccctgaacgaactctcgcagcagattcgtattcgcccccgctatgac
aactttatcggcggccagtgggtcgcgccggtcaagggccagtacttcaccaacgtgacc
cccgtcacgggcaagccgctctgcgatgtggcccgctcgaccgccgaggacatcgaagtc
gcgctcgacgccgcccacaaggcgcgcgccgactggggcaacgcgtctccggccacgcgc
gccggcgtgctcctcaaaatcgccgatcggatggaagccaacctcaagctgatcgccatg
gtcgagacgctcgacaacggcaagccgatccgcgagacgacggcggccgacatccccctc
gccatcgatcacttccgctacttcgcgggctgcctccgcgcccaggaaggctcgatcgcg
gagatcgatcacgacaccgtcgcctaccacttccatgagccgctcggcgtggtgggccag
atcatcccctggaacttcccgctgctgatggcctgctggaagctcgcgcccgcgctggcc
gcaggcaactgcgtcgtgctgaagcccgccgagcagacgcccatgagcatcatggtgctg
atggacctcatcggcgacctgctgccgccgggcgtgctcaacgtcgtcaacggcttcggc
atcgaggccggcaagccgctggcccagaacaagcgcatcgccaagatcgcattcacgggc
gagacgacgaccggccgcctcatcatgcagtacgcgtcggagaacatcattccctgcacg
ctggaactcggcggcaagagcccgaacatcttcttcgccgacgtcgccgatcacgacgac
gacttcttcgacaaggcgctcgaaggcttcgcgatgttcgcgctcaaccagggcgaggtc
tgcacctgcccgagccgtgctctcgtgcacgagagcatctacgaccgcttcatggaacgc
gccgtgaagcgcgtcgaagcgatcaagcagggccacccgctcgatagctcgacgatgatc
ggcgcgcaggcgtccaacgaccagctcgaaaagatcctctcctacatcaagatcggacag
gacgagggcgcgcaggtgctcacgggcggcgcgcgcaacatcctcgatggcgaagccgcc
gaaggctactacgtgaagccgacgatcctcgctggtcacaacaagatgcgcgtgttccag
gaagagatcttcgggccggtcgtctcggtcacgacgttcaaggacgacgaagaggcgctc
gccatcgccaacgacacgctttacggcctcggctcgggcgtgtggacgcgcaacggcacc
cgcgcctatcgcttcggccgcgcgatccaggccggccgcgtgtggacgaactgctaccac
ctctatccggcgcacgccgctttcggtggctacaagcagtccggcatcggccgcgaaacg
cacaagatgatgctcgaccactatcagcagaccaagaacatgctggtcagctacagcccc
aaggctttgggcttcttctaa

DBGET integrated database retrieval system