KEGG   Hymenobacter nivis: DDQ68_00425Help
Entry
DDQ68_00425       CDS       T05498                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hnv  Hymenobacter nivis
Pathway
hnv00473  D-Alanine metabolism
hnv00550  Peptidoglycan biosynthesis
hnv01100  Metabolic pathways
hnv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hnv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DDQ68_00425
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DDQ68_00425
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DDQ68_00425
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hnv01011]
    DDQ68_00425
Enzymes [BR:hnv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DDQ68_00425
Peptidoglycan biosynthesis and degradation proteins [BR:hnv01011]
 Precursor biosynthesis
  Amino acid ligase
   DDQ68_00425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AWM31385
UniProt: A0A2Z3GKE0
LinkDB All DBs
Position
78059..80797
Genome map
AA seq 912 aa AA seqDB search
MRIGIFFGGTSREREISFAGGRTVFDNLDKALFQPVPIFVDSLGRFLLLDWQYLYKGTIR
DFYPPMAALPPTAHPWSVYVESLGLPAGPQLDNHLSRVGRQVLPEELPLLMDFAFLALHG
PGGEDGAIQGLLEWLCLPYSGSGILPSAFGIDKVAQKRLLQAAGLPTPAFRVLTAAAWDA
ADPAAVLADTVGALGLPLVFKAPHQGSSIGISMLKESNLAAFEAAVERSLFRKKLTRAEW
QGLSEEGQRTWVQHLIDIREGIGLPVVLEAAAGALAAAAPAPIYHPEALLGTLTAWFETA
DAVRLASTHGETQVLVEAFVAGREFSCIVIEDEKGEPLALPPTEIVKGAEVFDYRSKYLP
GLARKITPIDLPEAEIERIRQQCQAMFCTFGFQVYARLDGFIQADGTIFLNDPNTTSGML
PASFFFHQAAEIGLNPSQFLTYLIRTSLAARRAGGMQPFKLGALLATLDAAVAERQQAGA
DGRIRVAVVMGGYSSERHISVESGRNIFEKLSSSAKYAPVPVFLTGSAAEHRLYVLPINV
MLKDNADDIREKIEHAEAGEGPHPILAKIQAEAGALTRTYAGQGLAQPRRISFEELAGLA
DEVFIALHGRPGEDGALQQELEKFGLPYNGSGVASSAVTINKFETNRRLRAAGLLVADHR
MAPRLEWAADPESFYCSLETQFPYPFIAKPADDGCSSAVKKIKNRAELAAFSELMFRDQE
DLPAGPAAVLHLGFKEEFPQKDAFLVETLISRDGAAHFLEVTGGLLTSYDEDGQLDIEVF
EASEALANGEVLSLEEKFLAGEGQNITPARYAAEPGERQRVSNEVKAVLRRVAEVLDIQG
YARIDAFVRVRPGGAVEVIIIEVNSLPGMTPATCIFHQTALAGYTPYQFVDRILEFGKAR
AGREKMEVRPSC
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggcatttttttcggaggcacttcgcgcgagcgggaaatttcgtttgccggg
ggccgcaccgtttttgataatttagacaaagcactatttcagccggtacccatttttgtg
gacagtctggggcgcttcctgctgcttgactggcaatacttatacaagggtaccatccgc
gatttttacccgccgatggccgcgctgccgcccacggcccacccgtggtcggtatacgtg
gagagcctgggcttgcccgcggggccccagctcgataaccacctgagccgcgtgggccgc
caggtgctgcccgaggaactgccgctgctgatggactttgccttcctggccctgcacggg
ccgggcggcgaggacggcgccatccagggcctgctggaatggctgtgtctgccgtattcg
ggctcgggcattttgccctccgcgttcggtatcgataaggtggcgcagaagcggctgctg
caagccgcgggcttgcccacgccggccttccgcgtcctcaccgccgccgcctgggacgct
gccgaccccgccgcggtgctggccgataccgtgggggccctgggcctgccgctggtattc
aaagcgccgcaccagggcagcagcatcggcatcagtatgctgaaggaaagcaacctggcc
gcgttcgaggcggccgtggagcgtagcttgttccgtaaaaaactgacccgcgccgagtgg
cagggcctgagcgaagaaggccagcgcacctgggtgcagcacttaattgatatccgcgag
ggcattggcctgcccgtggtgctcgaagccgccgccggggccctggccgccgccgcaccc
gcgcccatctaccaccccgaagcgttgctggggaccctaactgcctggtttgaaacggcc
gacgccgtgcgcctggccagcacccacggcgaaacccaggtactggtcgaagccttcgtg
gcgggccgcgagttcagttgcatcgttatcgaagacgaaaaaggcgagccgctggccctg
ccgcccaccgagattgtgaagggcgccgaggtgttcgactaccgctcgaaatacctgccc
ggcctggcccgcaaaatcacacccatcgacttgcccgaggctgaaattgagcgcatccgc
cagcagtgtcaggctatgttctgcacgtttggcttccaggtatatgcgcggctcgacggc
tttattcaggccgacggcaccatctttctcaacgacccgaacacgacgagcggcatgctg
ccggcctcgttcttcttccaccaggcggccgagattggcctgaaccccagtcagttcctt
acctacctcatccgcacgtcgctggcggcgcggcgggccggtggcatgcagccgttcaag
ctgggggccctgttggcgacgctcgacgcggcggtggccgagcggcagcaggccggtgcg
gacgggcgcatccgggtggccgtcgtcatgggcgggtactcttcggagcgccatatttcg
gtggaaagcgggcgcaatattttcgagaagctcagctcgtcggccaagtacgcgccggtg
ccggtgttcctcaccggctcggccgcggagcaccgcctctatgtattgcccatcaacgtg
atgctgaaggacaacgccgacgatatccgcgagaagattgagcacgccgaggccggcgag
gggccccatcccatcctggccaaaatccaggccgaggcgggggccctcacccgcacctac
gccgggcaggggctggcccaaccgcgccgcatctcgttcgaggagctggccgggctggcc
gacgaggtgttcatcgccctgcacggccgcccgggcgaggacggggccctgcaacaggaa
ttggagaaattcggcctgccctacaatggctcgggcgtggccagcagcgccgtcaccatc
aacaagttcgaaaccaaccgccgcctgcgcgccgccggcctgctggtggccgaccaccgc
atggccccgcgcctagagtgggccgccgaccccgaaagcttctactgcagcctggaaacg
cagtttccgtacccgttcatcgccaagccggccgatgatggctgctcgtcggcggtgaaa
aagattaagaaccgcgctgagctggcggccttctcggagttgatgttccgcgaccaggaa
gacctgccggcgggccccgccgcggtattgcacttgggcttcaaggaggagtttccgcag
aaagacgcctttttggtggagacgctgattagccgcgacggagccgcgcacttcctggaa
gtgaccggcggcctgctcacgagctacgacgaggacgggcagcttgacatcgaggtgttc
gaggccagcgaggccctggctaacggcgaggtgctaagcctggaggagaagttcctggcc
ggtgagggccagaacattacgcccgcccgctacgccgctgagcccggcgagcgccagcgc
gtgagcaacgaggtgaaggccgtgctgcgccgcgtggccgaggtgctcgacatccagggc
tacgcccgcatcgacgcctttgtgcgggtgcggccgggcggcgccgtggaggttatcatc
atcgaagtcaactcgctgcccggcatgacgcccgccacctgtatcttccaccaaacggcc
ctggccggctacacgccctaccagttcgtggaccggattttggagtttggcaaggcgcgg
gccgggcgggaaaagatggaagtaaggccgtcatgctga

DBGET integrated database retrieval system