KEGG   Hymenobacter nivis: DDQ68_07285Help
Entry
DDQ68_07285       CDS       T05498                                 

Gene name
aroF
Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
hnv  Hymenobacter nivis
Pathway
hnv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hnv01100  Metabolic pathways
hnv01110  Biosynthesis of secondary metabolites
hnv01130  Biosynthesis of antibiotics
hnv01230  Biosynthesis of amino acids
Module
hnv_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hnv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DDQ68_07285 (aroF)
Enzymes [BR:hnv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     DDQ68_07285 (aroF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 NeuB
Motif
Other DBs
NCBI-ProteinID: AWM32601
UniProt: A0A2Z3GJW6
LinkDB All DBs
Position
1662399..1663403
Genome map
AA seq 334 aa AA seqDB search
MILQLEPQASVPALAAHLAEQGYKTTDVTTQHAHYLVAIGKKDFDIRTIGQLPGVRDVHQ
VSDDYQLVSRKWRVKPTVIDLGDGVTIGEGSLALCAGPCSIESEAQMEKVMDHLLENGVR
LMRGGVFKPRSSPYAFRGLGMDGLRLFHQLARARGIKIVTEVMQVSQVEEMHDYVDVFQV
GARNTQNYNLLDALGGVDKPVLIKRGISGSIEELLSSAEYVFSGGNEKLILCERGIRTFE
TASRNTLDLNAVPILKEKTHLPVVVDPSHGIGLRDYVPAMALAAVLAGADGILYETHETP
ETAASDGQQTLNFAESSRLIRNLRRVYALRGELE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgattctccaactcgaaccccaggcctccgtgcccgccctggcggcgcacctggccgag
cagggctacaaaaccaccgacgttacgacccagcacgcgcactatttggtagccattggg
aagaaagatttcgacattcgcaccattggccagttgccgggcgtgcgcgatgtgcaccag
gtatcggatgactatcaattagttagccgcaagtggcgggttaagcccacggttattgac
ctgggcgatggcgtgaccattggcgagggcagcctggcgctgtgcgccggcccgtgcagc
atcgagagcgaggcccaaatggaaaaggtgatggaccacctgctcgaaaacggcgtgcgc
ctgatgcgcggcggcgtgttcaagccgcggtcgtcaccctacgcgtttcgtggtttgggc
atggacggtcttcgattattccatcaattggcccgggctcggggcatcaaaattgtgacc
gaggtaatgcaggtgtcgcaggtcgaggagatgcacgactacgtggacgtgttccaggtg
ggggcccgcaacacccagaactacaacctgctcgatgccctgggcggcgtcgacaagccg
gtgctcatcaagcgcggtatttcgggctcgattgaggagctgctttcgtcggccgagtac
gtgttttcgggcggtaacgagaagctgattttgtgcgaacggggcatccgcacgttcgaa
acagccagccgcaacacactggatttgaacgcggtgcccattctcaaggagaaaacccac
ctgcccgtggtggtggaccccagccacggcattggcctgcgcgactacgtgcccgccatg
gccctagccgccgtgctggccggcgccgatggcatcctctacgaaacccacgaaacgccg
gaaacggctgcttccgatggccagcagacgctgaactttgccgagtcgagccgtttgatt
cgtaacctgcgccgggtgtacgccctgcgcggcgagctggaatag

DBGET integrated database retrieval system