KEGG   Hymenobacter nivis: DDQ68_14385Help
Entry
DDQ68_14385       CDS       T05498                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
hnv  Hymenobacter nivis
Pathway
hnv00380  Tryptophan metabolism
hnv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hnv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    DDQ68_14385 (kynU)
Enzymes [BR:hnv01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     DDQ68_14385 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AWM33872
UniProt: A0A2Z3GNX0
LinkDB All DBs
Position
complement(3248244..3249527)
Genome map
AA seq 427 aa AA seqDB search
MSSALLDPTHAAALDAADPLAAFRAEFLFPNGPNGQPVAYFCGNSLGLQPKATRAALDAE
LTNWAELAVEGHFHGTAPWMHSHGPLAEASAPVVGALPHEVVIMNGLSVNLHLLLVSFYR
PAGARYKVLMEGGAFPSDQYAIETQARLHGLDPDDAIVELVPRPGEHTLRTEDIAVKIAE
LGDSLATVLLGGLNYYTGQVFDMAAITAAGHAVGATVGFDLAHAAGNVPLHLHDWDVDFA
CWCTYKYLNSGPGGIAGAYIHERFANRPDLLRLAGWWGQEPAERFQMKKGFRPTPGADGW
LLSNSPVLLLAPLRASLDLVARAGGMATLRAKSEPLTAYLESLIRALNLPADQLEIITPA
DPAQRGCQLSVLVHQRGRELFDYLAARGVVADWREPNVIRLSPVPLYNSFEDVRRAGAAM
HDFFAAG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctgcgctcctcgaccccacccacgccgccgcccttgatgcggccgacccgctg
gccgcttttcgcgccgaattcctgttccccaacgggcccaatggccagccggtggcctat
ttttgcggcaactcgctggggttgcagcccaaggctacccgcgccgccctcgacgccgag
ctgaccaactgggccgagctggccgtggagggccacttccacggcaccgcgccctggatg
cattcccacgggcccctggccgaggccagtgcgccggtggtgggggccctgccgcacgaa
gtggtgattatgaacggattgagcgtgaacctgcacctgctgctggtttccttctaccgg
cccgccggggcccgctacaaggtgctgatggaaggcggcgcgttcccctccgaccagtac
gccatcgaaacgcaggcccgcctgcatggcctcgaccccgacgacgccattgtggagctg
gtgccccgtcccggcgagcacacgctgcgcacggaggacattgccgtcaaaattgccgag
ttgggcgactcgctggccaccgtgctgctgggcgggctgaattactacaccgggcaggtg
ttcgacatggccgccatcacggccgccgggcacgcggtgggcgctaccgtgggcttcgac
ctggcccacgccgccggcaacgtgccgctgcacctgcacgactgggacgtggactttgcc
tgttggtgcacctacaagtacctgaattcggggcccggcggcattgccggggcctacata
cacgagcggtttgccaaccggcccgacctgctgcgcctggccggctggtggggccaggag
ccggccgagcggttccagatgaaaaaaggcttccgccccacgcccggcgccgacggctgg
ctgctgtcgaactcgccggtgctgctgctggctcccctgcgcgccagcctcgacctggtg
gcccgcgccgggggtatggccaccctgcgcgccaaaagcgagccgctcactgcttacctc
gaaagcctgatcagggccctgaacctgcccgccgaccagctcgaaatcatcacccctgcc
gaccccgcccagcgcggctgccagctctcggtgctggtgcaccagcgcgggcgcgaactg
ttcgactacctggccgcccggggcgtggtggccgactggcgcgagccaaatgtgattcgc
ctgtcgcccgtgccgctgtataattcgtttgaggacgtgcggcgggccggggcggcaatg
cacgatttttttgccgccggctag

DBGET integrated database retrieval system