KEGG   Hoeflea sp. IMCC20628: IMCC20628_00601Help
Entry
IMCC20628_00601   CDS       T03926                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
hoe  Hoeflea sp. IMCC20628
Pathway
hoe00240  Pyrimidine metabolism
hoe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hoe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    IMCC20628_00601
Enzymes [BR:hoe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     IMCC20628_00601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14 AAA_30
Motif
Other DBs
NCBI-ProteinID: AKH99325
UniProt: A0A0F7PGL0
LinkDB All DBs
Position
633688..634278
Genome map
AA seq 196 aa AA seqDB search
MAKLYFSYSTMNAGKSTLLLQASYNYRERGMRTVLFIAAFDDRGGAGRIASRIGLDCEAI
PFRPNDDLFQSLKELKADGEIACAFVDEAQFLTEAQVWQLARVADRLNVPVMSYGLRTDF
RGKLFPGSAALLAIADELREVRTICHCGRKATMVVRVNDEGRVIREGAQIEVGGNEKYVS
YCRRHWDDVMGQEAPE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
ttggccaagctatatttcagctactcgacaatgaatgcgggaaaatcgacgcttctgttg
caggcgtcctacaattaccgcgaacgcggcatgcgcaccgtgctgttcattgccgccttc
gatgatcgcggcggcgccgggcgcattgcctcgcggatcgggctggattgcgaggcgatc
ccgtttcggccgaatgacgatctgtttcaatcgctcaaggaactgaaggcggatggcgag
attgcctgtgccttcgtcgatgaagcgcaattcctgaccgaagctcaggtctggcaactg
gcgcgggtggccgaccggttgaatgtcccggtgatgagctatggcttgcgtactgatttt
cgcggcaaactgtttccgggctccgcagcgcttctggcgatcgcagatgaactcagagaa
gttcggacgatctgtcattgcgggcgcaaggcgacgatggttgtgcgcgtcaatgacgag
ggcagggtgatccgcgaaggcgcccagatcgaggtcggcggtaacgagaaatatgtgtcc
tattgtcgccgtcactgggatgacgtgatggggcaagaggctccggagtag

DBGET integrated database retrieval system