KEGG   Hoeflea sp. IMCC20628: IMCC20628_00968Help
Entry
IMCC20628_00968   CDS       T03926                                 

Definition
(GenBank) sugar phosphate isomerase/epimerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
hoe  Hoeflea sp. IMCC20628
Pathway
hoe00040  Pentose and glucuronate interconversions
hoe00051  Fructose and mannose metabolism
hoe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hoe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    IMCC20628_00968
   00051 Fructose and mannose metabolism
    IMCC20628_00968
Enzymes [BR:hoe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     IMCC20628_00968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 Rep_1B
Motif
Other DBs
NCBI-ProteinID: AKH99686
UniProt: A0A0F7PEW4
LinkDB All DBs
Position
1023741..1024700
Genome map
AA seq 319 aa AA seqDB search
MSYKNSILLGTIGGYRDRFHQFQPDRTFEERLEIAKKIPRTHGVEPVYPQDLGADGAGAK
TIQKSGLAVSAVNVNVKTEDKFRDGSFTNPDAGIRKEAVQYLKTSMDLAAELKAEMITVC
PLIDGWDYAFQADHIQQWRWMIEAFAEAAAHRDDVKVSIEYKAYESKNHIILPSMGRTLH
FCDRVGAKNLGVTMDVGHALIAGESPGSEIAVASEAGRLFYIHFNDNDRGADWDMLPASV
HLWETLETLHYMRRIGYDGWVAYDVFTRSGDNAEAIAATFEIMENLDALLDKIGDQKAKD
LITGGHPQRTYNDLIKALL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtcttataagaattccatcctgctcggcaccatcggtggttaccgggaccgttttcac
cagtttcagcctgaccgtacgtttgaagaacggcttgagatcgcaaagaagatcccgcgt
acccatggggtggagccggtctatccgcaggacctcggggcagatggagccggcgccaag
acaattcagaagagtggactggcagtgtctgccgtcaacgtcaatgtcaagaccgaggac
aagttcagggacggctcctttaccaatcctgacgccggaattcgcaaggaagctgtgcag
tacctgaagacctcgatggacctcgccgccgagttgaaagccgagatgataactgtctgt
ccgctgatcgacggctgggattatgcgtttcaggccgaccatattcagcaatggcgctgg
atgatcgaagcttttgctgaggctgcagcgcaccgcgacgacgtcaaggtcagcatcgaa
tacaaggcctatgaatcgaagaaccacatcatccttccatccatgggccgcaccttgcat
ttctgtgaccgggtcggtgccaagaatctcggcgtgacgatggatgttggccatgccctg
atcgcaggtgaaagccccggatcggagatcgcggttgcctcggaagcggggcggttgttc
tacatccacttcaacgacaatgaccgtggcgccgattgggacatgttgccggcttccgtc
cacctgtgggagacgctggaaacgctgcattacatgcgccgtatcggttatgacggctgg
gtggcttatgacgtcttcacacgctccggcgacaatgccgaagccatcgcggcaacgttc
gagatcatggaaaatctcgatgccctgctcgacaagatcggtgaccagaaggccaaggat
cttatcacgggcggccatccacagcggacctacaacgacctgatcaaggcactgctgtga

DBGET integrated database retrieval system