KEGG   Hoeflea sp. IMCC20628: IMCC20628_01076Help
Entry
IMCC20628_01076   CDS       T03926                                 

Definition
(GenBank) 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
hoe  Hoeflea sp. IMCC20628
Pathway
hoe00061  Fatty acid biosynthesis
hoe00780  Biotin metabolism
hoe01100  Metabolic pathways
hoe01212  Fatty acid metabolism
Module
hoe_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hoe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    IMCC20628_01076
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    IMCC20628_01076
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hoe01004]
    IMCC20628_01076
Enzymes [BR:hoe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     IMCC20628_01076
Lipid biosynthesis proteins [BR:hoe01004]
 Fatty acid synthase
  Component type
   IMCC20628_01076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA
Motif
Other DBs
NCBI-ProteinID: AKH99793
UniProt: A0A0F7PKS6
LinkDB All DBs
Position
complement(1136359..1136844)
Genome map
AA seq 161 aa AA seqDB search
MQLEYFQMIDRIEALDLDAGTLVASSTVPGSSPVFEGHFPGMPLVPGVLLIETMAQASGF
LVLAATDFAAMPFLMSVDGAKMRDFVKPGALLEITATLEHEGSGFAVTKARISSGGKKVA
DCQLKLRTVAFDQVPLAGIVRTRAEEVGLLTAMAKASGDQL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttgaatacttccagatgatcgaccgcattgaggcgcttgatcttgatgcaggc
actctggttgcaagttcgaccgtacccggctccagcccggtgttcgaaggtcatttcccc
ggcatgccactggttcccggggtgcttctgattgaaaccatggcacaggccagcggattt
ctggttctggccgcgacggattttgcggctatgccgttcctgatgtcggttgatggcgcc
aaaatgcgtgatttcgtcaagcccggcgcattgctggaaatcaccgccacgctggagcac
gaaggctccggtttcgctgttaccaaggcaagaatatcaagtggcgggaaaaaagtggcc
gattgccagctcaaactgagaaccgtcgcctttgaccaggttccgcttgccggtatcgtt
cgcacccgggccgaggaagtggggcttttgaccgccatggcgaaagcatcaggagaccag
ctatga

DBGET integrated database retrieval system