KEGG   Hoeflea sp. IMCC20628: IMCC20628_01093Help
Entry
IMCC20628_01093   CDS       T03926                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hoe  Hoeflea sp. IMCC20628
Pathway
hoe00564  Glycerophospholipid metabolism
hoe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hoe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    IMCC20628_01093
Enzymes [BR:hoe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     IMCC20628_01093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox_2 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AKH99810
UniProt: A0A0F7PI33
LinkDB All DBs
Position
1153412..1154917
Genome map
AA seq 501 aa AA seqDB search
MAEDKLYDVFVIGGGINGCGIARDAIGRGYSVFLAEMNDLASGTSSWSSKLIHGGFRYLE
YYEFRLVRESLSEREVLLANAPHIIWPMRFVLPHHTDMRPAWLLRLGLFLYDHIGTRKLL
PGTTTVDLKTSPVGKPLKPIFSKGFEYSDCWVNDARLVVLNARDAADRGAVIRTRTEVVS
AERQDGVWAVTLADRMTGVRQTVKARLIVNAGGPWVDRILSGVVGRNNAHNVRLVQGSHI
VVPKLHDHDRAYIFQNGDGRIIFAMPYEEDFTLIGTTDQDYEGDPKDVVITDPEIDYLCA
AASEYFAKPVERQSIVWTYSGVRPLYDDGASAAQEATRDYVLKPDPAEGAPLLNIFGGKI
TTARKLAESMLDLIEARLGKKSAPWTHRAALPGGDFPADGFEDQVTQLYSDYPFLEPKQA
RRYVRQYGTRARVLLGEAKSVADLGQDFGYGLYGREVDYLMVQEWALEAADVIWRRTKRG
LRLTPEQVAGLEAYMAAKTTA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagacaagctctatgatgttttcgtcatcggcggcggcatcaacgggtgtggc
atcgcccgtgacgcgatcgggcgcggctattcggtgtttctcgcggagatgaacgatctt
gcctcgggcacatcgtcgtggtcgtcgaaactgatccatggcggcttccgctatctcgaa
tattatgaattcaggctggtgcgggaatcgctgagcgagcgcgaagtgctgctggccaat
gcgccgcacattatctggccgatgcgtttcgtgctgccgcaccacaccgacatgcgtccg
gcctggctgctgcggctcgggctgttcctgtatgaccatatcggcacgcgcaaactgctg
cccggcaccacgacggtggatctcaagacatcgccggtcggcaagccgctgaagccgatc
ttctccaaagggttcgagtattccgattgctgggtcaacgacgcccggctggtggtgctc
aatgcccgcgatgcggcggatcggggcgctgtcatccgcacccgcacagaggtggtgtcg
gcagaacgccaggatggcgtctgggcggtcacccttgccgaccggatgacgggcgtccgc
caaaccgtcaaggcacggctgatcgtcaatgccggcgggccgtgggtggaccggatcctg
tccggcgttgtcgggcgcaacaacgcgcacaatgtgcgtctggtacaaggcagccacatc
gtggtgccgaaactgcatgaccatgaccgcgcctatatcttccagaatggcgacgggcgg
attattttcgcgatgccttatgaagaggattttaccctgatcggcaccaccgatcaggat
tacgaaggcgatccgaaggatgtggtgatcaccgatccggagatcgattatctgtgcgct
gcggcgagcgaatatttcgccaagccggtggagcgccaatcgatcgtctggacctattcc
ggtgtccgtcctctttatgatgacggtgcttcggcggcgcaggaagccacccgcgactac
gttctcaagcctgacccggcggaaggtgcgccgctgctcaatattttcggcggcaagatc
accacggcccgcaaactggcggaatcgatgctcgatctgatcgaagcccggcttggcaag
aagtccgcgccatggacccacagggcagcccttccgggtggcgattttccggcggatggt
tttgaagatcaggtgacgcagttgtactccgattacccgtttctcgagcccaaacaggcg
cggcgctatgtccgccaatatggcacgcgggcgcgggttctgctcggcgaggccaagtcg
gtagcggatctggggcaggatttcggctacggtctttacgggagagaggtcgactatctg
atggtgcaggaatgggcgctggaggcggccgatgtgatctggcggcgcaccaaacgcggg
cttcgcctgacacctgaacaggtggcggggcttgaggcctacatggcggcaaaaaccacg
gcataa

DBGET integrated database retrieval system