KEGG   Hoeflea sp. IMCC20628: IMCC20628_01219Help
Entry
IMCC20628_01219   CDS       T03926                                 

Definition
(GenBank) dimethylsulfoniopropionate demethylase
  KO
K17486  dimethylsulfoniopropionate demethylase [EC:2.1.1.269]
Organism
hoe  Hoeflea sp. IMCC20628
Pathway
hoe00920  Sulfur metabolism
hoe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hoe00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    IMCC20628_01219
Enzymes [BR:hoe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.269  dimethylsulfoniopropionate demethylase
     IMCC20628_01219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AKH99935
UniProt: A0A0F7PIE8
LinkDB All DBs
Position
1283283..1284389
Genome map
AA seq 368 aa AA seqDB search
MPPFLSISRRTRRTPFTDRVTAAGVSAYTVYNRMLLPTVFKSVVEDYHHLKTAVQVWDVA
CERQVEIRGPQAAELVQMLTPRDLSEMVVGQCLYTPMVDETGGMLNDPVTVKLEEDRYWV
SIADSDLLLWVKALAVGFRLAVDVIEPDVSPLAIQGPRADDLAARVFGDEVRSIRFFRYK
RLAFNGVDLVVARSGYSKQGGFEIYVEGGQNGEPLWDALFEAGRDLDVRAGCPNLIERIE
AGMLSYGNDMTRANTPHECGLGRFCDTRSAIGCVGRDALLRVAREGPLKQIRYLEIEGDA
VPPCPEPWMVSAGGELVGQITSASWSPDFNTNVAISMIGRDCWDEGTVVDVATPDGNRSA
RVRDKSWL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgccgccatttctgtcgatttcccgccgcacccggcgcaccccttttacggaccgtgtc
actgcggcgggcgtgtcggcctatacggtctacaaccgcatgctgctgccgaccgtgttc
aagtcggttgtcgaggactatcaccatctcaagaccgccgttcaggtctgggatgtggcc
tgcgaacggcaggtggaaatccgcgggccgcaggcagccgaactggtgcagatgctgacc
ccgcgggatctctcggagatggtggtcgggcaatgcctctacacgccgatggttgacgag
accggcggcatgctcaacgatccggtcaccgtcaagctcgaagaggatcgctactgggtg
tcaatcgctgacagcgatcttctcttgtgggtcaaggcgctggcggtgggcttccggctg
gctgtcgacgtgatcgaacccgacgtgtcgccgctggcgatccagggcccgcgcgccgat
gatctggccgcccgggtgtttggcgacgaagtccgttcgatccggttcttccgctacaag
cgcctggccttcaatggcgtcgatctggtcgtcgcccgctcgggctattccaaacagggc
gggttcgagatctatgtcgagggtggacagaacggcgagccgctgtgggacgcgctgttc
gaagccggccgggatctcgatgtgcgtgccggatgccccaacctgatcgaacgcatcgag
gcggggatgctgtcttatggcaatgacatgacccgcgccaacacgccgcatgaatgcggg
ctcggccgcttctgcgataccagatcagccatcggctgcgtcggacgggacgcgcttttg
cgggtcgccagggaaggtccgctcaagcagatccgctatctggaaatcgaaggtgacgcg
gtgcctccgtgcccggagccgtggatggtgagtgccggtggagagttggttggccagatc
acctcggcgtcctggtcgcctgacttcaataccaatgtggcgatctccatgatcggccgc
gattgctgggacgagggaaccgtggttgacgtcgccacccctgacggcaaccgctcggcg
cgggtgcgtgacaaaagctggttgtaa

DBGET integrated database retrieval system